2LGY: Ubiquitin-like domain from HOIL-1

Name: PDB 2LGY: Ubiquitin-like domain from HOIL-1
Published: 2012-06-20
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Ubiquitin-like domain from HOIL-1. Determined by solution NMR. Released 20 Jun 2012.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 728
Mol. weight: 10.35 kDa
Released: 20 Jun 2012

Explore 2LGY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LGY contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	6-14	9	1
β-strand	19-26	8	1
β-strand	31	1	2
α-helix	32-43	12
β-strand	51-53	3	1
β-strand	64	1	2
α-helix	66-68	3
β-strand	75-81	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RanBP-type and C3HC4-type zinc finger-containing protein 1	A	protein	90	Homo sapiens	Q9BYM8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LGY_1 RanBP-type and C3HC4-type zinc finger-containing protein 1 (chains A)
MPTQDIRLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLAR
DQETLHSHGVRQNGDSAYLYLLSARNTSLN

Primary citation

Solution structure of the E3 ligase HOIL-1 Ubl domain. Beasley, S.A., Safadi, S.S., Barber, K.R. et al. Protein Sci (2012) 21:1085-1092. DOI 10.1002/pro.2080 · PubMed

Other PDB entries of the same protein (UniProt Q9BYM8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8K6Q 1.59 Å, Crystal structure of HOIL-1L LTM domain
9EGW 1.78 Å, HOIL-1 RING2 domain bound to ubiquitin-maltose (maltose not modelled)
7YUJ 1.86 Å, Crystal structure of HOIL-1L(365-510)
7V8E 1.9 Å, Crystal structure of IpaH1.4 LRR domain bound to HOIL-1L UBL domain.
9EGV 2.0 Å, HOIL-1 RING2 domain bound to ubiquitin
8BVL 2.24 Å, Crystal structure of the IBR-RING2 domain of HOIL-1
7YUI 2.6 Å, Crystal structure of HOIL-1L(195-423) in complex with the linear tetra-ubiquitin
4DBG 2.71 Å, Crystal structure of HOIL-1L-UBL complexed with a HOIP-UBA derivative
8EAZ 3.08 Å, HOIL-1/E2-Ub/Ub transthiolation complex
2CRC Solution structure of the zf-RanBP domain of the protein HBV associated factor

Browse structure collections

About this viewer

MolViewer shows 2LGY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.