2CRF: Ran_BP1 domain of RAN-binding protein-3

Solution structure of the Ran_BP1 domain of RAN-binding protein-3. Determined by solution NMR. Released 20 Nov 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,148
Mol. weight: 16.46 kDa
Released: 20 Nov 2005

Explore 2CRF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CRF contains 2 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	27-40	14	1
β-strand	45-60	16	1
β-strand	67-75	9	1
β-strand	81-86	6	1
β-strand	93-94	2	1
β-strand	100-107	8	1
β-strand	113-119	7	1
α-helix	122-143	22
α-helix	147-149	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RAN binding protein 3	A	protein	150	Homo sapiens	Q9H6Z4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2CRF_1 RAN binding protein 3 (chains A)
GSSGSSGTARKCLLEKVEVITGEEAESNVLQMQCKLFVFDKTSQSWVERGRGLLRLNDMA
STDDGTLQSRLVMRTQGSLRLILNTKLWAQMQIDKASEKSIHITAMDTEDQGVKVFLISA
SSKDTGQLYAALHHRILALRSRVESGPSSG

Primary citation

Solution structure of the Ran_BP1 domain of RAN-binding protein-3. Zhang, H.P., Nagashima, T., Hayashi, F. et al. To be published.

Other PDB entries of the same protein (UniProt Q9H6Z4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Y8G 1.61 Å, Structure of the Ran-binding domain from human RanBP3 (E352A-R353V double mutant)
2Y8F 2.1 Å, Structure of the Ran-binding domain from human RanBP3 (wild type)
5XZX 3.0 Å, Crystal structure of importin-alpha3 bound to the nuclear localization signal of…

Browse structure collections

About this viewer

MolViewer shows 2CRF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.