2CS5: PDB entry 2CS5

Solution structure of PDZ domain of Protein tyrosine phosphatase, non-receptor type 4. Determined by solution NMR. Released 20 Nov 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 889
Mol. weight: 12.71 kDa
Released: 20 Nov 2005

Explore 2CS5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2CS5 contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	17-21	5	1
β-strand	31-36	6	1
α-helix	37-39	3
β-strand	41-48	8	1
β-strand	66-70	5	1
β-strand	73	1	1
α-helix	80-92	13
β-strand	98-103	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase, non-receptor type 4	A	protein	119	Homo sapiens	P29074 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2CS5_1 Tyrosine-protein phosphatase, non-receptor type 4 (chains A)
GSSGSSGNGGIPHDNLVLIRMKPDENGRFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPR
LNEGDQVVLINGRDIAEHTHDQVVLFIKASCERHSGELMLLVRPNAVYDVVEESGPSSG

Primary citation

Solution structure of PDZ domain of Protein tyrosine phosphatase, non-receptor type 4. Nagashima, T., Hayashi, F., Yokoyama, S. To be published.

Other PDB entries of the same protein (UniProt P29074 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3NFK 1.43 Å, Crystal structure of the PTPN4 PDZ domain complexed with the C-terminus of a rabies…
2VPH 1.9 Å, Crystal structure of the human protein tyrosine phosphatase, non- receptor type 4, PDZ…
3NFL 1.91 Å, Crystal structure of the PTPN4 PDZ domain complexed with the C-terminus of the GluN2A…
5EYZ 2.09 Å, Crystal structure of the PTPN4 PDZ domain complexed with the tailored peptide CYTO8-retev
5EZ0 2.35 Å, Crystal structure of the PTPN4 PDZ domain complexed with the PDZ binding motif of the…
2I75 2.45 Å, Crystal Structure of Human Protein Tyrosine Phosphatase N4 (PTPN4)
7VZE 2.88 Å, Crystal structure of PTPN4 PDZ bound to the PBM of HPV16 E6

Browse structure collections

About this viewer

MolViewer shows 2CS5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.