Solution structure of the CH domain from human EH domain binding protein 1. Determined by solution NMR. Released 2 Jun 2006.
Explore 2D89 in 3D Show helices and sheets RCSB PDB PDBe
2D89 contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 11-21 | 11 | |
| α-helix | 35-38 | 4 | |
| α-helix | 41-50 | 10 | |
| α-helix | 57-59 | 3 | |
| α-helix | 66-79 | 14 | |
| α-helix | 87-92 | 6 | |
| α-helix | 98-112 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| EHBP1 protein | A | protein | 119 | Homo sapiens | Q8NDI1 (AlphaFold model) |
>2D89_1 EHBP1 protein (chains A) GSSGSSGPNASQSLLVWCKEVTKNYRGVKITNFTTSWRNGLSFCAILHHFRPDLIDYKSL NPQDIKENNKKAYDGFASIGISRLLEPSDMVLLAIPDKLTVMTYLYQIRAHFSSGPSSG
Solution structure of the CH domain from human EH domain binding protein 1. Tomizawa, T., Kigawa, T., Koshiba, S. et al. To be published.
Other PDB entries of the same protein (UniProt Q8NDI1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2D89 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.