2D89: CH domain from human EH domain binding protein 1

Solution structure of the CH domain from human EH domain binding protein 1. Determined by solution NMR. Released 2 Jun 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 927
Mol. weight: 13.19 kDa
Released: 2 Jun 2006

Explore 2D89 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2D89 contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	11-21	11
α-helix	35-38	4
α-helix	41-50	10
α-helix	57-59	3
α-helix	66-79	14
α-helix	87-92	6
α-helix	98-112	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
EHBP1 protein	A	protein	119	Homo sapiens	Q8NDI1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2D89_1 EHBP1 protein (chains A)
GSSGSSGPNASQSLLVWCKEVTKNYRGVKITNFTTSWRNGLSFCAILHHFRPDLIDYKSL
NPQDIKENNKKAYDGFASIGISRLLEPSDMVLLAIPDKLTVMTYLYQIRAHFSSGPSSG

Primary citation

Solution structure of the CH domain from human EH domain binding protein 1. Tomizawa, T., Kigawa, T., Koshiba, S. et al. To be published.

Other PDB entries of the same protein (UniProt Q8NDI1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ZSI 1.91 Å, The mechanism of activation of the actin binding protein EHBP1 by Rab8 family members.
6ZSJ 2.0 Å, The mechanism of activation of the actin binding protein EHBP1 by Rab8 family members.
6ZSH 2.2 Å, The mechanism of activation of the actin binding protein EHBP1 by Rab8 family members

Browse structure collections

About this viewer

MolViewer shows 2D89 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.