2DAD: Absent in melanoma 1 protein

Solution structure of the fifth crystall domain of the non-lens protein, Absent in melanoma 1. Determined by solution NMR. Released 13 Jun 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 695
Mol. weight: 9.9 kDa
Released: 13 Jun 2006

Explore 2DAD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DAD contains 2 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	8-14	7	1
β-strand	18-24	7	1
α-helix	32-34	3
β-strand	39-43	5	1
β-strand	46-50	5	2
β-strand	59-60	2	2
β-strand	65-67	3	1
α-helix	70-73	4
β-strand	83-87	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Absent in melanoma 1 protein	A	protein	93	Homo sapiens	Q9Y4K1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DAD_1 Absent in melanoma 1 protein (chains A)
GSSGSSGQIHLFSEPQFQGHSQSFEETTSQIDDSFSTKSCRVSGGSWVVYDGENFTGNQY
VLEEGHYPCLSAMGCPPGATFKSLRFISGPSSG

Primary citation

Solution structure of the fifth crystall domain of the non-lens protein, Absent in melanoma 1. Ohnishi, S., Kigawa, T., Saito, K. et al. To be published.

Other PDB entries of the same protein (UniProt Q9Y4K1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CW3 1.88 Å, Crystal structure of AIM1g1
6VRO 2.45 Å, The structure of the PP2A B56 subunit AIM1 complex

Browse structure collections

About this viewer

MolViewer shows 2DAD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.