6VRO: PP2A B56 subunit AIM1 complex

The structure of the PP2A B56 subunit AIM1 complex. Determined by X-ray diffraction at 2.45 Å resolution. Released 25 Mar 2020.

Method: X-ray diffraction
Resolution: 2.45 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,813
Mol. weight: 44.71 kDa
Released: 25 Mar 2020

Explore 6VRO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6VRO contains 26 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 0 β-strands

Element	Residues	Length
α-helix	38-48	11
α-helix	62-81	20
α-helix	91-103	13
α-helix	131-146	16
α-helix	152-155	4
α-helix	161-169	9
α-helix	170-172	3
α-helix	176-192	17
α-helix	194-196	3
α-helix	197-213	17
α-helix	221-233	13
α-helix	239-240	2
α-helix	241-246	6
α-helix	247-251	5
α-helix	253-255	3
α-helix	260-277	18
α-helix	279-281	3
α-helix	282-291	10
α-helix	301-312	12
α-helix	317-320	4
α-helix	324-335	12
α-helix	340-347	8
α-helix	348-351	4
α-helix	353-360	8
α-helix	363-370	8

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	731-734	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform	A	protein	355	Homo sapiens	Q13362 (AlphaFold model)
Beta/gamma crystallin domain-containing protein 1	B	protein	26	Homo sapiens	Q9Y4K1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6VRO_1 Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform (chains A)
GHMGSRDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRN
VITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFL
ESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQIN
NIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHP
QLAYCVVQFLEKDSTLTEPVVMALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKIME
PLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPSLYRNSKT

Sequence of entity 2 (B), FASTA

>6VRO_2 Beta/gamma crystallin domain-containing protein 1 (chains B)
KRKKARMPNSPAPHFAMPPIHEDHLE

Primary citation

A dynamic charge-charge interaction modulates PP2A:B56 substrate recruitment. Wang, X., Garvanska, D.H., Nasa, I. et al. Elife (2020) 9. DOI 10.7554/eLife.55966 · PubMed

Other PDB entries of the same protein (UniProt Q13362 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5JJA 2.35 Å, Crystal structure of a PP2A B56gamma/BubR1 complex
2JAK 2.6 Å, Human PP2A regulatory subunit B56g
3FGA 2.7 Å, Structural Basis of PP2A and Sgo interaction
5K6S 2.79 Å, The structure of the PP2A B56 subunit BubR1 complex
5SWF 2.82 Å, The structure of the PP2A B56 subunit double phosphorylated BubR1 complex
5SW9 2.85 Å, The structure of the PP2A B56 subunit RepoMan complex
9GNJ 2.85 Å, Crystal structure of a PP2A B56gamma double phosphorylated BRCA2 complex
7OUF 3.0 Å, Structure of the STLV intasome:B56 complex bound to the strand-transfer inhibitor XZ450
7OUG 3.1 Å, STLV-1 intasome:B56 in complex with the strand-transfer inhibitor raltegravir
6OYL 3.15 Å, The structure of the PP2A B56 subunit KIF4A complex
6TOQ 3.16 Å, Crystal structure of a PP2A B56y/HTLV-1 integrase complex
9MF5 3.2 Å, CryoEM structure of the Protein Phosphatase 2A (Abeta-B56gamma-Calpha) holoenzyme complex

Browse structure collections

About this viewer

MolViewer shows 6VRO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.