Solution structure of first LIM domain of Enigma-like PDZ and LIM domains protein. Determined by solution NMR. Released 12 Dec 2006.
Explore 2DAR in 3D Show helices and sheets RCSB PDB PDBe
2DAR contains 2 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 14 | 1 | 1 |
| β-strand | 17-19 | 3 | 2 |
| α-helix | 20 | 1 | |
| β-strand | 27 | 1 | 3 |
| β-strand | 28 | 1 | 2 |
| β-strand | 34 | 1 | 3 |
| β-strand | 39-42 | 4 | 2 |
| β-strand | 45-47 | 3 | 2 |
| β-strand | 53 | 1 | 4 |
| β-strand | 60 | 1 | 4 |
| β-strand | 66 | 1 | 1 |
| β-strand | 67-68 | 2 | 5 |
| β-strand | 73-74 | 2 | 5 |
| α-helix | 76-82 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| PDZ and LIM domain protein 5 | A | protein | 90 | Homo sapiens | Q96HC4 (AlphaFold model) |
>2DAR_1 PDZ and LIM domain protein 5 (chains A) GSSGSSGDQDTLVQRAEHIPAGKRTPMCAHCNQVIRGPFLVALGKSWHPEEFNCAHCKNT MAYIGFVEEKGALYCELCYEKFFASGPSSG
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Solution structure of first LIM domain of Enigma-like PDZ and LIM domains protein. Niraula, T.N., Muto, Y., Koshiba, S. et al. To be published.
Other PDB entries of the same protein (UniProt Q96HC4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2DAR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.