2UZC: Human PDLIM5

Structure of human PDLIM5 in complex with the C-terminal peptide of human alpha-actinin-1. Determined by X-ray diffraction at 1.5 Å resolution. Released 8 May 2007.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: HOMO SAPIENS
Chains: 5
Atoms: 3,772
Mol. weight: 46.92 kDa
Released: 8 May 2007

Explore 2UZC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2UZC contains 20 α-helices and 30 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	1
α-helix	13	1
β-strand	16-21	6	1
α-helix	22-24	3
β-strand	26-33	8	1
α-helix	38-41	4
α-helix	48	1
β-strand	49-53	5	1
β-strand	56-57	2	1
α-helix	63-71	9
β-strand	76-82	7	1

Chain B: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	2
β-strand	16-21	6	2
α-helix	22-24	3
β-strand	26-33	8	2
α-helix	38-41	4
β-strand	49-53	5	2
β-strand	56-57	2	2
α-helix	63-72	10
β-strand	77-82	6	2

Chain C: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	3
α-helix	9	1
β-strand	16-19	4	3
β-strand	29-33	5	3
α-helix	38-41	4
α-helix	48	1
β-strand	49-53	5	3
β-strand	56-57	2	3
α-helix	63-71	9
β-strand	77-82	6	3

Chain D: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	4
α-helix	13	1
β-strand	16-21	6	4
α-helix	22-24	3
β-strand	26-33	8	4
α-helix	38-41	4
β-strand	49-53	5	4
β-strand	56-57	2	4
α-helix	63-72	10
β-strand	76-82	7	4

Chain E: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	5
α-helix	13	1
β-strand	16-19	4	5
β-strand	29-33	5	5
α-helix	38-41	4
α-helix	48	1
β-strand	49-53	5	5
β-strand	56-57	2	5
α-helix	63-71	9
β-strand	76-82	7	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PDZ and lim domain 5	A, B, C, D, E	protein	88	HOMO SAPIENS	Q96HC4 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>2UZC_1 PDZ AND LIM DOMAIN 5 (chains A, B, C, D, E)
SMSNYSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKAAQANVRIGDVVLSIDGINAQ
GMTHLEAQNKIKGCTGSLNMTLQRESDL

Primary citation

Unusual binding interactions in PDZ domain crystal structures help explain binding mechanisms. Elkins, J.M., Gileadi, C., Shrestha, L. et al. Protein Sci (2010) 19:731-741. DOI 10.1002/pro.349 · PubMed

Other PDB entries of the same protein (UniProt Q96HC4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9F6S 1.0 Å, PDZ domain in complex with the peptide from AP2-associated protein kinase 1
2DAR Solution structure of first LIM domain of Enigma-like PDZ and LIM domains protein

Browse structure collections

About this viewer

MolViewer shows 2UZC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.