2DAY: RWD domain of human ring finger protein 25

Solution structure of the RWD domain of human ring finger protein 25. Determined by solution NMR. Released 14 Jun 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 983
Mol. weight: 13.97 kDa
Released: 14 Jun 2006

Explore 2DAY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DAY contains 3 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	12-23	12
β-strand	28-31	4	1
β-strand	40-46	7	1
β-strand	60-67	8	1
β-strand	77-84	8	1
α-helix	88-104	17
α-helix	111-122	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RING finger protein 25	A	protein	128	Homo sapiens	Q96BH1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DAY_1 RING finger protein 25 (chains A)
GSSGSSGEEDWVLPSEVEVLESIYLDELQVIKGNGRTSPWEIYITLHPATAEDQDSQYVC
FTLVLQVPAEYPHEVPQISIRNPRGLSDEQIHTILQVLGHVAKAGLGTAMLYELIEKGKE
ILSGPSSG

Primary citation

Solution structure of the RWD domain of human ring finger protein 25. Yoneyama, M., Kigawa, T., Sato, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q96BH1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5D1M 1.58 Å, Crystal Structure of UbcH5B in Complex with the RING-U5BR Fragment of AO7 (P199A)
5D1L 1.62 Å, Crystal Structure of UbcH5B in Complex with the RING-U5BR Fragment of AO7 (Y165A)
5D1K 1.78 Å, Crystal Structure of UbcH5B in Complex with the RING-U5BR Fragment of AO7
2DMF An extended conformation of the RWD domain of human Ring finger protein 25

Browse structure collections

About this viewer

MolViewer shows 2DAY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.