2DMF: RING finger protein 25

An extended conformation of the RWD domain of human Ring finger protein 25. Determined by solution NMR. Released 21 Oct 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,052
Mol. weight: 14.95 kDa
Released: 21 Oct 2006

Explore 2DMF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DMF contains 5 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	12-23	12
β-strand	28-31	4	1
β-strand	40-46	7	1
α-helix	52-54	3
β-strand	60-67	8	1
β-strand	77-84	8	1
α-helix	88-104	17
α-helix	111-124	14
α-helix	128-129	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RING finger protein 25	A	protein	137	Homo sapiens	Q96BH1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DMF_1 RING finger protein 25 (chains A)
GSSGSSGEEDWVLPSEVEVLESIYLDELQVIKGNGRTSPWEIYITLHPATAEDQDSQYVC
FTLVLQVPAEYPHEVPQISIRNPRGLSDEQIHTILQVLGHVAKAGLGTAMLYELIEKGKE
ILTDNNIPHGQSGPSSG

Primary citation

An extended conformation of the RWD domain of human Ring finger protein 25. Yoneyama, M., Tochio, N., Koshiba, S. et al. To be published.

Other PDB entries of the same protein (UniProt Q96BH1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5D1M 1.58 Å, Crystal Structure of UbcH5B in Complex with the RING-U5BR Fragment of AO7 (P199A)
5D1L 1.62 Å, Crystal Structure of UbcH5B in Complex with the RING-U5BR Fragment of AO7 (Y165A)
5D1K 1.78 Å, Crystal Structure of UbcH5B in Complex with the RING-U5BR Fragment of AO7
2DAY Solution structure of the RWD domain of human ring finger protein 25

Browse structure collections

About this viewer

MolViewer shows 2DMF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.