2DBG: Myeloid cell nuclear differentiation antigen

Solution structure of the Pyrin (PAAD-DAPIN) domain in human Myeloid cell nuclear differentiation antigen. Determined by solution NMR. Released 15 Jun 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 803
Mol. weight: 11.51 kDa
Released: 15 Jun 2006

Explore 2DBG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DBG contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	11-16	6
α-helix	17-21	5
α-helix	26-40	15
α-helix	44-49	6
α-helix	52-62	11
α-helix	67-75	9
α-helix	80-82	3
α-helix	83-96	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myeloid cell nuclear differentiation antigen	A	protein	103	Homo sapiens	P41218 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DBG_1 Myeloid cell nuclear differentiation antigen (chains A)
GSSGSSGMVNEYKKILLLKGFELMDDYHFTSIKSLLAYDLGLTTKMQEEYNRIKITDLME
KKFQGVACLDKLIELAKDMPSLKNLVNNLRKEKSKVASGPSSG

Primary citation

Solution structure of the Pyrin (PAAD-DAPIN) domain in human Myeloid cell nuclear differentiation antigen. Saito, K., Inoue, M., Koshiba, S. et al. To be published.

Other PDB entries of the same protein (UniProt P41218 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5H7Q 1.45 Å, Crystal structure of human MNDA PYD domain with MBP tag
5WPZ 2.0 Å, Crystal structure of MNDA PYD with MBP tag
8I6K 2.4 Å, Structure of hMNDA HIN with dsDNA

Browse structure collections

About this viewer

MolViewer shows 2DBG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.