8I6K: HMNDA HIN with dsDNA

Structure of hMNDA HIN with dsDNA. Determined by X-ray diffraction at 2.4 Å resolution. Released 19 Jul 2023.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: Homo sapiens, synthetic construct
Chains: 3
Atoms: 2,003
Mol. weight: 32.07 kDa
Released: 19 Jul 2023

Explore 8I6K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8I6K contains 8 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	212-219	8	1
α-helix	220-222	3
β-strand	223-225	3	2
β-strand	233-235	3	2
β-strand	236-241	6	1
β-strand	246-251	6	1
α-helix	254-256	3
β-strand	265-268	4	1
β-strand	272-274	3	1
β-strand	277-280	4	1
α-helix	283-285	3
β-strand	286-288	3	1
α-helix	297-304	8
α-helix	305-308	4
α-helix	309-312	4
α-helix	316	1
β-strand	320-332	13	3
β-strand	336-343	8	3
β-strand	346-353	8	3
α-helix	354-356	3
β-strand	366-377	12	3
β-strand	380-384	5	3
β-strand	390-394	5	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myeloid cell nuclear differentiation antigen	A	protein	217	Homo sapiens	P41218 (AlphaFold model)
DNA (5'-d(gpgpcpgpcpgpcpgpcpgpcpc)-3')	B, C	DNA	12	synthetic construct

Sequence of entity 1 (A), FASTA

>8I6K_1 Myeloid cell nuclear differentiation antigen (chains A)
GSVDQVDARRNVPQNDPVTVVVLKATAPFKYESPENGKSTMFHATVASKTQYFHVKVFDI
NLKEKFVRKKVITISDYSECKGVMEIKEASSVSDFNQNFEVPNRIIEIANKTPKISQLYK
QASGTMVYGLFMLQKKSVHKKNTIYEIQDNTGSMDVVGSGKWHNIKCEKGDKLRLFCLQL
RTVDRKLKLVCGSHSFIKVIKAKKNKEGPMNVNAAAS

Sequence of entity 2 (B, C), FASTA

>8I6K_2 DNA (5'-D(*GP*GP*CP*GP*CP*GP*CP*GP*CP*GP*CP*C)-3') (chains B, C)
GGCGCGCGCGCC

Primary citation

Structural mechanism of dsDNA recognition by the hMNDA HIN domain: New insights into the DNA-binding model of a PYHIN protein. Li, Y., Zhang, C., Samad, A. et al. Int J Biol Macromol (2023) 245:125461-125461. DOI 10.1016/j.ijbiomac.2023.125461 · PubMed

Other PDB entries of the same protein (UniProt P41218 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5H7Q 1.45 Å, Crystal structure of human MNDA PYD domain with MBP tag
5WPZ 2.0 Å, Crystal structure of MNDA PYD with MBP tag
2DBG Solution structure of the Pyrin (PAAD-DAPIN) domain in human Myeloid cell nuclear…

Browse structure collections

About this viewer

MolViewer shows 8I6K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.