2DGV: Heterogeneous nuclear ribonucleoprotein M

Solution structure of the RNA binding domain in Heterogeneous nuclear ribonucleoprotein M. Determined by solution NMR. Released 16 Sept 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 699
Mol. weight: 10.08 kDa
Released: 16 Sept 2006

Explore 2DGV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DGV contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	653-656	4	1
α-helix	665-673	9
β-strand	678-685	8	1
β-strand	690-698	9	1
α-helix	701-711	11
β-strand	716	1	2
β-strand	719	1	2
β-strand	724-725	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heterogeneous nuclear ribonucleoprotein M	A	protein	92	Homo sapiens	P52272 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DGV_1 Heterogeneous nuclear ribonucleoprotein M (chains A)
GSSGSSGACQIFVRNLPFDFTWKMLKDKFNECGHVLYADIKMENGKSKGCGVVKFESPEV
AERACRMMNGMKLSGREIDVRIDRNASGPSSG

Primary citation

Solution structure of the RNA binding domain in Heterogeneous nuclear ribonucleoprotein M. Abe, C., Muto, Y., Inoue, M. et al. To be published.

Other PDB entries of the same protein (UniProt P52272 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2OT8 3.1 Å, Karyopherin Beta2/Transportin-hnRNPM NLS Complex
2DH9 Solution structure of the C-terminal RNA binding domain in Heterogeneous nuclear…
2DO0 Solution structure of the RNA binding domain of heterogeneous nuclear ribonucleoprotein M

Browse structure collections

About this viewer

MolViewer shows 2DGV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.