Karyopherin Beta2/Transportin-hnRNPM NLS Complex. Determined by X-ray diffraction at 3.1 Å resolution. Released 10 Apr 2007.
Explore 2OT8 in 3D Show helices and sheets RCSB PDB PDBe
2OT8 contains 131 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 12-22 | 11 | |
| α-helix | 28-37 | 10 | |
| α-helix | 47-55 | 9 | |
| α-helix | 63-78 | 16 | |
| α-helix | 84-96 | 13 | |
| α-helix | 104-120 | 17 | |
| α-helix | 129-136 | 8 | |
| α-helix | 142-157 | 16 | |
| α-helix | 165-168 | 4 | |
| α-helix | 172-181 | 10 | |
| α-helix | 182-184 | 3 | |
| α-helix | 188-199 | 12 | |
| α-helix | 207-211 | 5 | |
| α-helix | 213-223 | 11 | |
| α-helix | 229-245 | 17 | |
| α-helix | 247-250 | 4 | |
| α-helix | 251-253 | 3 | |
| α-helix | 254-266 | 13 | |
| α-helix | 270-284 | 15 | |
| α-helix | 289-293 | 5 | |
| α-helix | 294-296 | 3 | |
| α-helix | 297-307 | 11 | |
| α-helix | 313-318 | 6 | |
| α-helix | 375-389 | 15 | |
| α-helix | 392-394 | 3 | |
| α-helix | 395-406 | 12 | |
| α-helix | 411-423 | 13 | |
| α-helix | 425-428 | 4 | |
| α-helix | 430-432 | 3 | |
| α-helix | 436-446 | 11 | |
| α-helix | 452-463 | 12 | |
| α-helix | 466-471 | 6 | |
| α-helix | 478-488 | 11 | |
| α-helix | 494-510 | 17 | |
| α-helix | 513-518 | 6 | |
| α-helix | 519-532 | 14 | |
| α-helix | 535-552 | 18 | |
| α-helix | 553-556 | 4 | |
| α-helix | 559-575 | 17 | |
| α-helix | 583-596 | 14 | |
| α-helix | 599-601 | 3 | |
| α-helix | 602-628 | 27 | |
| α-helix | 634-636 | 3 | |
| α-helix | 639-654 | 16 | |
| α-helix | 656-659 | 4 | |
| α-helix | 660-665 | 6 | |
| α-helix | 668-675 | 8 | |
| α-helix | 681-697 | 17 | |
| α-helix | 699-702 | 4 | |
| α-helix | 703-705 | 3 | |
| α-helix | 706-715 | 10 | |
| α-helix | 722-739 | 18 | |
| α-helix | 740-743 | 4 | |
| α-helix | 747-759 | 13 | |
| α-helix | 765-781 | 17 | |
| α-helix | 783-786 | 4 | |
| α-helix | 787-792 | 6 | |
| α-helix | 794-801 | 8 | |
| α-helix | 808-821 | 14 | |
| α-helix | 825-827 | 3 | |
| α-helix | 829-831 | 3 | |
| α-helix | 832-839 | 8 | |
| α-helix | 849-864 | 16 | |
| α-helix | 866-870 | 5 | |
| α-helix | 872-875 | 4 | |
| α-helix | 878-886 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 13-15 | 3 | |
| α-helix | 16-19 | 4 | |
| α-helix | 30-40 | 11 | |
| α-helix | 51-56 | 6 | |
| α-helix | 68-78 | 11 | |
| α-helix | 87-95 | 9 | |
| α-helix | 104-119 | 16 | |
| α-helix | 129-133 | 5 | |
| α-helix | 142-160 | 19 | |
| α-helix | 172-175 | 4 | |
| α-helix | 176-182 | 7 | |
| α-helix | 188-198 | 11 | |
| α-helix | 199-201 | 3 | |
| α-helix | 207-211 | 5 | |
| α-helix | 213-223 | 11 | |
| α-helix | 229-245 | 17 | |
| α-helix | 247-250 | 4 | |
| α-helix | 251-253 | 3 | |
| α-helix | 254-265 | 12 | |
| α-helix | 270-284 | 15 | |
| α-helix | 289-292 | 4 | |
| α-helix | 293-295 | 3 | |
| α-helix | 297-307 | 11 | |
| α-helix | 313-317 | 5 | |
| α-helix | 375-389 | 15 | |
| α-helix | 392-394 | 3 | |
| α-helix | 395-406 | 12 | |
| α-helix | 411-423 | 13 | |
| α-helix | 425-432 | 8 | |
| α-helix | 433-435 | 3 | |
| α-helix | 436-446 | 11 | |
| α-helix | 452-463 | 12 | |
| α-helix | 466-471 | 6 | |
| α-helix | 478-489 | 12 | |
| α-helix | 494-511 | 18 | |
| α-helix | 512-518 | 7 | |
| α-helix | 519-532 | 14 | |
| α-helix | 535-552 | 18 | |
| α-helix | 553-556 | 4 | |
| α-helix | 559-575 | 17 | |
| α-helix | 584-596 | 13 | |
| α-helix | 599-601 | 3 | |
| α-helix | 602-628 | 27 | |
| α-helix | 634-636 | 3 | |
| α-helix | 639-655 | 17 | |
| α-helix | 656-659 | 4 | |
| α-helix | 660-664 | 5 | |
| α-helix | 668-677 | 10 | |
| α-helix | 681-697 | 17 | |
| α-helix | 699-702 | 4 | |
| α-helix | 703-705 | 3 | |
| α-helix | 706-715 | 10 | |
| α-helix | 722-739 | 18 | |
| α-helix | 740-746 | 7 | |
| α-helix | 747-759 | 13 | |
| α-helix | 765-781 | 17 | |
| α-helix | 783-786 | 4 | |
| α-helix | 787-789 | 3 | |
| α-helix | 790-801 | 12 | |
| α-helix | 808-821 | 14 | |
| α-helix | 825-829 | 5 | |
| α-helix | 832-841 | 10 | |
| α-helix | 847-864 | 18 | |
| α-helix | 866-872 | 7 | |
| α-helix | 878-888 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transportin-1 | A, B | protein | 852 | Homo sapiens | Q92973 (AlphaFold model) |
| Heterogeneous nuclear ribonucleoprotein M | C, D | protein | 30 | Homo sapiens | P52272 (AlphaFold model) |
>2OT8_1 Transportin-1 (chains A, B) MEYEWKPDEQGLQQILQLLKESQSPDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSE DEPTRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASK GELQNWPDLLPKLCSLLDSEDYNTCEGAFGALQKICEDSAEILDSDVLDRPLNIMIPKFL QFFKHSSPKIRSHAVACVNQFIISRTQALMLHIDSFIENLFALAGDEEPEVRKNVCRALV MLLEVRMDRLLPHMHNIVEYMLQRTQDQDENVALEACEFWLTLAEQPICKDVLVRHLPKL IPVLVNGMKYSDIDIILLKGDVEGGSGGDDTISDWNLRKCSAAALDVLANVYRDELLPHI LPLLKELLFHHEWVVKESGILVLGAIAEGCMQGMIPYLPELIPHLIQCLSDKKALVRSIT CWTLSRYAHWVVSQPPDTYLKPLMTELLKRILDSNKRVQEAACSAFATLEEEACTELVPY LAYILDTLVFAFSKYQHKNLLILYDAIGTLADSVGHHLNKPEYIQMLMPPLIQKWNMLKD EDKDLFPLLECLSSVATALQSGFLPYCEPVYQRCVNLVQKTLAQAMLNNAQPDQYEAPDK DFMIVALDLLSGLAEGLGGNIEQLVARSNILTLMYQCMQDKMPEVRQSSFALLGDLTKAC FQHVKPCIADFMPILGTNLNPEFISVCNNATWAIGEISIQMGIEMQPYIPMVLHQLVEII NRPNTPKTLLENTAITIGRLGYVCPQEVAPMLQQFIRPWCTSLRNIRDNEEKDSAFRGIC TMISVNPSGVIQDFIFFCDAVASWINPKDDLRDMFCKILHGFKNQVGDENWRRFSDQFPL PLKERLAAFYGV
>2OT8_2 Heterogeneous nuclear ribonucleoprotein M (chains C, D) ERPAQNEKRKEKNIKRGGNRFEPYANPTKR
Structure-based design of a pathway-specific nuclear import inhibitor. Cansizoglu, A.E., Lee, B.J., Zhang, Z.C. et al. Nat Struct Mol Biol (2007) 14:452-454. DOI 10.1038/nsmb1229 · PubMed
Other PDB entries of the same protein (UniProt Q92973 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2OT8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.