2DH2: Human ED-4F2hc

Crystal Structure of human ED-4F2hc. Determined by X-ray diffraction at 2.1 Å resolution. Released 27 Mar 2007.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,412
Mol. weight: 47.01 kDa
Released: 27 Mar 2007

Explore 2DH2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DH2 contains 25 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	117-119	3
β-strand	123-126	4	1
α-helix	129-133	5
α-helix	140-144	5
α-helix	147-152	6
β-strand	157-160	4	1
β-strand	164-166	3	2
β-strand	174-179	6	2
α-helix	181-183	3
α-helix	186-198	13
β-strand	202-206	5	1
α-helix	222-239	18
β-strand	243-246	4	1
α-helix	249-251	3
α-helix	255-269	15
β-strand	274-278	5	1
α-helix	284-290	7
β-strand	298-300	3	1
α-helix	311-325	15
α-helix	328-330	3
β-strand	331-332	2	3
α-helix	340-342	3
α-helix	346-356	11
β-strand	362-363	2	3
β-strand	364-366	3	1
α-helix	369-371	3
α-helix	375-377	3
α-helix	386-388	3
α-helix	404-406	3
α-helix	408-412	5
α-helix	418-431	14
α-helix	433-437	5
β-strand	439-443	5	4
β-strand	444	1	5
β-strand	449-455	7	4
α-helix	460	1
β-strand	461-467	7	4
β-strand	473-474	2	6
β-strand	478	1	5
α-helix	484-486	3
α-helix	487-489	3
β-strand	491-497	7	4
β-strand	507-509	3	4
α-helix	510-512	3
β-strand	514-515	2	6
β-strand	520-525	6	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
4F2 cell-surface antigen heavy chain	A	protein	424	Homo sapiens	P08195 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DH2_1 4F2 cell-surface antigen heavy chain (chains A)
DRWGSELPAQKWWHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHK
NQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTV
ATKVKDALEFWLQAGVDGFQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQ
QILSLLESNKDLLLTSSYLSDSGSTGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLP
AQLLRLYQLMLFTLPGTPVFSYGDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVSAN
MTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVV
LNFGDVGLSAGLQASDLPASASLPAKADLLLSTQPGREEGSPLELERLKLEPHEGLLLRF
PYAA

Primary citation

The structure of human 4F2hc ectodomain provides a model for homodimerization and electrostatic interaction with plasma membrane. Fort, J., de la Ballina, L.R., Burghardt, H.E. et al. J Biol Chem (2007) 282:31444-31452. DOI 10.1074/jbc.M704524200 · PubMed

Other PDB entries of the same protein (UniProt P08195 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6S8V 1.8 Å, Structure of the high affinity Anticalin P3D11 in complex with the human CD98 heavy…
8G0M 2.25 Å, Structure of complex between TV6.6 and CD98hc ECD
9KJU 2.7 Å, Local refinement of the y+LAT1-4F2hc bound with Arg
2DH3 2.8 Å, Crystal Structure of human ED-4F2hc
7DF1 2.81 Å, Crystal structure of human CD98 heavy chain extracellular domain in complex with S1-F4…
7CMI 2.9 Å, The LAT2-4F2hc complex in complex with leucine
7DSK 2.9 Å, Overall structure of the LAT1-4F2hc bound with JX-075
7DSL 2.9 Å, Overall structure of the LAT1-4F2hc bound with JX-078
8YLP 2.9 Å, Overall structure of the y+LAT1-4F2hc bound with Arg
7DSN 3.1 Å, Overall structure of the LAT1-4F2hc bound with JX-119
8X0W 3.1 Å, Overall structure of the LAT1-4F2hc bound with Leu
8A6L 3.18 Å, Human 4F2hc-LAT2 heterodimeric amino acid transporter in complex with anticalin D11vs

Browse structure collections

About this viewer

MolViewer shows 2DH2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.