Solution structure of the TUDOR domain of Tudor and KH domain containing protein. Determined by solution NMR. Released 30 Sept 2006.
Explore 2DIQ in 3D Show helices and sheets RCSB PDB PDBe
2DIQ contains 6 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-23 | 14 | |
| α-helix | 27-29 | 3 | |
| β-strand | 38-41 | 4 | 1 |
| β-strand | 50-54 | 5 | 1 |
| β-strand | 63-67 | 5 | 1 |
| β-strand | 73-76 | 4 | 1 |
| α-helix | 78-80 | 3 | |
| β-strand | 82-83 | 2 | 1 |
| α-helix | 86-89 | 4 | |
| α-helix | 99 | 1 | |
| α-helix | 107-109 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tudor and KH domain-containing protein | A | protein | 110 | Homo sapiens | Q9Y2W6 (AlphaFold model) |
>2DIQ_1 Tudor and KH domain-containing protein (chains A) GSSGSSGRSLQLDKLVNEMTQHYENSVPEDLTVHVGDIVAAPLPTNGSWYRARVLGTLEN GNLDLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECSLARIASGPSSG
Solution structure of the TUDOR domain of Tudor and KH domain containing protein. Dang, W., Muto, Y., Inoue, M. et al. To be published.
Other PDB entries of the same protein (UniProt Q9Y2W6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2DIQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.