2DKL: Trinucleotide Repeat Containing 6C Protein

Solution Structure of the UBA Domain in the Human Trinucleotide Repeat Containing 6C Protein (hTNRC6C). Determined by solution NMR. Released 12 Oct 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 620
Mol. weight: 8.95 kDa
Released: 12 Oct 2006

Explore 2DKL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DKL contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	17-31	15
α-helix	35-44	10
α-helix	49-57	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Trinucleotide Repeat Containing 6C Protein	A	protein	85	Homo sapiens	Q9HCJ0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DKL_1 Trinucleotide Repeat Containing 6C Protein (chains A)
GSSGSSGGMKTSGKQDEAWIMSRLIKQLTDMGFPREPAEEALKSNNMNLDQAMSALLEKK
VDVDKRGLGVTDHNGMAAKSGPSSG

Primary citation

Solution Structure of the UBA Domain in the Human Trinucleotide Repeat Containing 6C Protein (hTNRC6C). Zhao, C., Kigawa, T., Yoneyama, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q9HCJ0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2X04 1.49 Å, Crystal structure of the PABC-TNRC6C complex
3KTP 1.5 Å, Structural basis of GW182 recognition by poly(A)-binding protein
7RUQ 1.79 Å, Structure of the human GIGYF1-TNRC6C complex

Browse structure collections

About this viewer

MolViewer shows 2DKL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.