2DKW: Bromodomain of human protein KIAA1240

Solution structure of the bromodomain of human protein KIAA1240. Determined by solution NMR. Released 14 Oct 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,030
Mol. weight: 14.71 kDa
Released: 14 Oct 2006

Explore 2DKW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DKW contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	8-26	19
α-helix	28-30	3
α-helix	50-58	9
α-helix	66-81	16
α-helix	90-111	22
α-helix	117-124	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
hypothetical protein KIAA1240	A	protein	131	Homo sapiens	Q9ULI0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DKW_1 hypothetical protein KIAA1240 (chains A)
GSSGSSGNTLRELRLFLRDVTKRLATDKRFNIFSKPVSDYLEVIKEPMDLSTVITKIDKH
NYLTAKDFLKDIDLICSNALEYNPDKDPGDKIIRHRACTLKDTAHAIIAAELDPEFNKLC
EEIKESGPSSG

Primary citation

Solution structure of the bromodomain of human protein KIAA1240. Sano, R., Hayashi, F., Kurosaki, C. et al. To be published.

Other PDB entries of the same protein (UniProt Q9ULI0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8UK5 1.4 Å, Crystal structure of the bromodomain of human ATAD2B in complex with histone H4S1(ph)K5ac
8UHL 1.92 Å, ATAD2B bromodomain in complex with histone H4 acetylated at lysine 12
3LXJ 2.33 Å, Crystal Structure of the Bromodomain of Human AAA domain containing 2B (ATAD2B)
6VEO 2.4 Å, ATAD2B bromodomain in complex with 4-({[(3R,4R)-4-{[3-methyl-5-(5-methylpyridin-3-yl)-2-o…
8SDX 2.69 Å, ATAD2B bromodomain in complex with histone H4 acetylated at lysine 5 with Serine 1…

Browse structure collections

About this viewer

MolViewer shows 2DKW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.