8UK5: Bromodomain of human ATAD2B

Crystal structure of the bromodomain of human ATAD2B in complex with histone H4S1(ph)K5ac. Determined by X-ray diffraction at 1.4 Å resolution. Released 5 Jun 2024.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,399
Mol. weight: 17.17 kDa
Released: 5 Jun 2024

Explore 8UK5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8UK5 contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	952-954	3
α-helix	955-976	22
α-helix	978-983	6
α-helix	995-998	4
α-helix	1005-1013	9
α-helix	1020-1037	18
α-helix	1043-1066	24
α-helix	1069-1080	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ATPase family AAA domain-containing protein 2B	A	protein	136	Homo sapiens	Q9ULI0 (AlphaFold model)
Histone H4S1(ph)K5ac	B	protein	14	Homo sapiens	P62805 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8UK5_1 ATPase family AAA domain-containing protein 2B (chains A)
GPLEDQEENTLRELRLFLRDVTKRLATDKRFNIFSKPVDIEEVSDYLEVIKEPMDLSTVI
TKIDKHNYLTAKDFLKDIDLICSNALEYNPDKDPGDKIIRHRACTLKDTAHAIIAAELDP
EFNKLCEEIKEARIKR

Sequence of entity 2 (B), FASTA

>8UK5_2 Histone H4S1(ph)K5ac (chains B)
SGRGKGGKGLGKGG

Primary citation

Impact of Combinatorial Histone Modifications on Acetyllysine Recognition by the ATAD2 and ATAD2B Bromodomains. Phillips, M., Malone, K.L., Boyle, B.W. et al. J Med Chem (2024) 67:8186-8200. DOI 10.1021/acs.jmedchem.4c00210 · PubMed

Other PDB entries of the same protein (UniProt Q9ULI0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8UHL 1.92 Å, ATAD2B bromodomain in complex with histone H4 acetylated at lysine 12
3LXJ 2.33 Å, Crystal Structure of the Bromodomain of Human AAA domain containing 2B (ATAD2B)
6VEO 2.4 Å, ATAD2B bromodomain in complex with 4-({[(3R,4R)-4-{[3-methyl-5-(5-methylpyridin-3-yl)-2-o…
8SDX 2.69 Å, ATAD2B bromodomain in complex with histone H4 acetylated at lysine 5 with Serine 1…
2DKW Solution structure of the bromodomain of human protein KIAA1240

Browse structure collections

About this viewer

MolViewer shows 8UK5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.