2DL1: MIT domain from human Spartin

Solution structure of the MIT domain from human Spartin. Determined by solution NMR. Released 14 Oct 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 895
Mol. weight: 12.77 kDa
Released: 14 Oct 2006

Explore 2DL1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DL1 contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	11-35	25
α-helix	38-56	19
α-helix	69-98	30

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Spartin	A	protein	116	Homo sapiens	Q8N0X7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DL1_1 Spartin (chains A)
GSSGSSGEPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISS
KESEHTGPGWESARQMQQKMKETLQNVRTRLEILEKGLATSLQNDLQEVPSGPSSG

Primary citation

Solution structure of the MIT domain from human Spartin. Suetake, T., Hayashi, F., Yokoyama, S. To be published.

Other PDB entries of the same protein (UniProt Q8N0X7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4U7I 1.79 Å, Structure of the complex of Spartin MIT and IST1 MIM

Browse structure collections

About this viewer

MolViewer shows 2DL1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.