4U7I: Complex of Spartin MIT and IST1 MIM

Structure of the complex of Spartin MIT and IST1 MIM. Determined by X-ray diffraction at 1.79 Å resolution. Released 11 Feb 2015.

Method: X-ray diffraction
Resolution: 1.79 Å
Organism: Homo sapiens
Chains: 2
Atoms: 964
Mol. weight: 13.8 kDa
Released: 11 Feb 2015

Explore 4U7I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4U7I contains 4 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	11-35	25
α-helix	39-57	19
α-helix	69-96	28

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	321-332	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Spartin	A	protein	95	Homo sapiens	Q8N0X7 (AlphaFold model)
IST1 homolog	B	protein	25	Homo sapiens	P53990 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4U7I_1 Spartin (chains A)
SGEPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEH
TGPGWESARQMQQKMKETLQNVRTRLEILEKGLAT

Sequence of entity 2 (B), FASTA

>4U7I_2 IST1 homolog (chains B)
STSASEDIDFDDLSRRFEELKKKTW

Primary citation

Distinct Mechanisms of Recognizing Endosomal Sorting Complex Required for Transport III (ESCRT-III) Protein IST1 by Different Microtubule Interacting and Trafficking (MIT) Domains. Guo, E.Z., Xu, Z. J Biol Chem (2015) 290:8396-8408. DOI 10.1074/jbc.M114.607903 · PubMed

Other PDB entries of the same protein (UniProt Q8N0X7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2DL1 Solution structure of the MIT domain from human Spartin

Browse structure collections

About this viewer

MolViewer shows 4U7I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.