Solution structure of the second SH3 domain of human KIAA0769 protein. Determined by solution NMR. Released 17 Oct 2006.
Explore 2DL7 in 3D Show helices and sheets RCSB PDB PDBe
2DL7 contains 0 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-13 | 5 | 1 |
| β-strand | 17 | 1 | 2 |
| β-strand | 24 | 1 | 1 |
| β-strand | 27 | 1 | 2 |
| β-strand | 32-37 | 6 | 1 |
| β-strand | 47-51 | 5 | 1 |
| β-strand | 54-58 | 5 | 1 |
| β-strand | 63-65 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| KIAA0769 protein | A | protein | 73 | Homo sapiens | O94868 (AlphaFold model) |
>2DL7_1 KIAA0769 protein (chains A) GSSGSSGVCFVKALYDYEGQTDDELSFPEGAIIRILNKENQDDDGFWEGEFNGRIGVFPS VLVEELSSGPSSG
Solution structure of the second SH3 domain of human KIAA0769 protein. Qin, X.R., Kurosaki, C., Yoshida, M. et al. To be published.
Other PDB entries of the same protein (UniProt O94868 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2DL7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.