High resolution crystal structure of the fv fragment from an anti-dansyl switch variant antibody IGG2A(S) crystallized at PH 6.75. Determined by X-ray diffraction at 1.55 Å resolution. Released 17 Dec 1999.
Explore 2DLF in 3D Show helices and sheets RCSB PDB PDBe
2DLF contains 8 α-helices and 25 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 4 |
| β-strand | 11-12 | 2 | 5 |
| β-strand | 18-25 | 8 | 4 |
| α-helix | 29-31 | 3 | |
| β-strand | 33-40 | 8 | 6 |
| β-strand | 44-51 | 8 | 6 |
| α-helix | 52B-53 | 3 | |
| β-strand | 57-59 | 3 | 6 |
| β-strand | 67-72 | 6 | 4 |
| α-helix | 73-75 | 3 | |
| β-strand | 77-82 | 6 | 4 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-95 | 8 | 6 |
| β-strand | 100B | 1 | 6 |
| β-strand | 107-109 | 3 | 6 |
| β-strand | 110-111 | 2 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-3 | 2 | |
| β-strand | 4-7 | 4 | 1 |
| β-strand | 10-13 | 4 | 2 |
| β-strand | 19-25 | 7 | 1 |
| β-strand | 27C | 1 | 3 |
| β-strand | 31 | 1 | 3 |
| β-strand | 33-38 | 6 | 2 |
| β-strand | 45-49 | 5 | 2 |
| β-strand | 53-54 | 2 | 2 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 70-75 | 6 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 2 |
| α-helix | 96 | 1 | |
| β-strand | 97-98 | 2 | 2 |
| β-strand | 102-106 | 5 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein (anti-dansyl immunoglobulin IGG2A(S)-kappa (light chain)) | L | protein | 113 | Mus musculus | P01631 (AlphaFold model) |
| Protein (anti-dansyl immunoglobulin IGG2A(S) (heavy chain)) | H | protein | 124 | Mus musculus | P01801 (AlphaFold model) |
>2DLF_1 PROTEIN (ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S)-KAPPA (LIGHT CHAIN)) (chains L) DVVMTQTPLSLPVSLGNQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRF SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPFTFGSGTKLEIKR
>2DLF_2 PROTEIN (ANTI-DANSYL IMMUNOGLOBULIN IGG2A(S) (HEAVY CHAIN)) (chains H) EVKLEESGGGLVQPGGSMKLSCATSGFTFSDAWMDWVRQSPEKGLEWVAEIRNKANNHAT YYAESVKGRFTISRDDSKRRVYLQMNTLRAEDTGIYYCTGIYYHYPWFAYWGQGTLVTVS AEPR
The pH-dependent structural variation of complementarity-determining region H3 in the crystal structures of the Fv fragment from an anti-dansyl monoclonal antibody. Nakasako, M., Takahashi, H., Shimba, N. et al. J Mol Biol (1999) 291:117-134. DOI 10.1006/jmbi.1999.2931 · PubMed
Other PDB entries of the same protein (UniProt P01631 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2DLF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.