Solution structure of the second fn3 domain of human receptor-type tyrosine-protein phosphatase delta. Determined by solution NMR. Released 18 Oct 2006.
Explore 2DLH in 3D Show helices and sheets RCSB PDB PDBe
2DLH contains 0 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 23-27 | 5 | 1 |
| β-strand | 34 | 1 | 2 |
| β-strand | 37-40 | 4 | 1 |
| β-strand | 49-55 | 7 | 3 |
| β-strand | 77-78 | 2 | 1 |
| β-strand | 81 | 1 | 2 |
| β-strand | 88-91 | 4 | 4 |
| β-strand | 92-97 | 6 | 3 |
| β-strand | 101 | 1 | 3 |
| β-strand | 108-111 | 4 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Receptor-type tyrosine-protein phosphatase delta | A | protein | 121 | Homo sapiens | P23468 (AlphaFold model) |
>2DLH_1 Receptor-type tyrosine-protein phosphatase delta (chains A) GSSGSSGPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDP TQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGSGPSS G
Solution structure of the second fn3 domain of human receptor-type tyrosine-protein phosphatase delta. Seimiya, K., Hayashi, F., Yoshida, M. et al. To be published.
Other PDB entries of the same protein (UniProt P23468 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2DLH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.