2YD6: Ptprd protein

Crystal structure of the N-terminal Ig1-2 module of Human Receptor Protein Tyrosine Phosphatase Delta. Determined by X-ray diffraction at 1.35 Å resolution. Released 13 Apr 2011.

Method: X-ray diffraction
Resolution: 1.35 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,925
Mol. weight: 23.7 kDa
Ligands: FLC
Released: 13 Apr 2011

Explore 2YD6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2YD6 contains 7 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	22-28	7	1
β-strand	33-36	4	2
β-strand	41-50	10	1
α-helix	52-53	2
β-strand	54-59	6	2
β-strand	62-63	2	2
β-strand	69-74	6	1
α-helix	75-77	3
β-strand	79-84	6	1
β-strand	94-102	9	2
β-strand	105-116	12	2
α-helix	118-120	3
α-helix	121-122	2
β-strand	127-130	4	3
β-strand	135-138	4	4
β-strand	143-150	8	3
α-helix	154-155	2
β-strand	156-161	6	4
β-strand	164-165	2	4
β-strand	175-180	6	3
β-strand	183-188	6	3
α-helix	193-195	3
β-strand	197-205	9	4
β-strand	208-211	4	4
α-helix	212-214	3
β-strand	215-220	6	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ptprd protein	A	protein	212	HOMO SAPIENS	P23468 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2YD6_1 PTPRD PROTEIN (chains A)
ETGETPPRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDG
SGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLREDQIPRGFPTIDMGPQLKVV
ERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSESIGALQIEQSEESDQG
KYECVATNSAGTRYSAPANLYVRGTKHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
FLC	Citrate anion	C6 H5 O7	1

Water and common crystallization additives (CL) are not listed.

Primary citation

Proteoglycan-Specific Molecular Switch for Rptp Sigma Clustering and Neuronal Extension. Coles, C.H., Shen, Y., Tenney, A.P. et al. Science (2011) 332:484. DOI 10.1126/SCIENCE.1200840 · PubMed

Other PDB entries of the same protein (UniProt P23468 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6X3A 1.77 Å, Crystal structure of the FN4-FN6 domains of human PTPRD
2YD7 1.98 Å, Crystal structure of the N-terminal Ig1-2 module of Human Receptor Protein Tyrosine…
4RCA 2.99 Å, Crystal structure of human PTPdelta and human Slitrk1 complex
5WY8 3.07 Å, Crystal structure of PTP delta Ig1-Ig3 in complex with IL1RAPL1 Ig1-Ig3
5XNP 3.73 Å, Crystal structures of human SALM5 in complex with human PTPdelta
1X5Z Solution structure of the fibronectin type-III domain of human protein tyrosine…
2DLH Solution structure of the second fn3 domain of human receptor-type tyrosine-protein…

Browse structure collections

About this viewer

MolViewer shows 2YD6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.