2DLR: Regulator of G-protein signaling 10

Solution structure of the RGS domain of human Regulator of G-protein signaling 10. Determined by solution NMR. Released 20 Oct 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,210
Mol. weight: 17.25 kDa
Released: 20 Oct 2006

Explore 2DLR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DLR contains 11 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	12-17	6
α-helix	19-24	6
α-helix	26-39	14
α-helix	43-57	15
α-helix	60-71	12
α-helix	88-90	3
α-helix	93-97	5
α-helix	103-115	13
α-helix	116-120	5
α-helix	121-125	5
α-helix	127-136	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Regulator of G-protein signaling 10	A	protein	149	Homo sapiens	O43665 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DLR_1 Regulator of G-protein signaling 10 (chains A)
GSSGSSGSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDK
TQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSY
SRFLKSDLFLKHKRTEEEEEDLPSGPSSG

Primary citation

Solution structure of the RGS domain of human Regulator of G-protein signaling 10. Zhang, H.P., Nagashima, T., Hayashi, F. et al. To be published.

Other PDB entries of the same protein (UniProt O43665 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2IHB 2.71 Å, Crystal structure of the heterodimeric complex of human RGS10 and activated Gi alpha 3
2I59 Solution structure of RGS10

Browse structure collections

About this viewer

MolViewer shows 2DLR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.