Solution structure of the TFIIS domain II of human PHD finger protein 3. Determined by solution NMR. Released 21 Oct 2006.
Explore 2DME in 3D Show helices and sheets RCSB PDB PDBe
2DME contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-28 | 20 | |
| α-helix | 37-55 | 19 | |
| α-helix | 60-69 | 10 | |
| α-helix | 71-74 | 4 | |
| α-helix | 81-87 | 7 | |
| α-helix | 94-97 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| PHD finger protein 3 | A | protein | 120 | Homo sapiens | Q92576 (AlphaFold model) |
>2DME_1 PHD finger protein 3 (chains A) GSSGSSGSADQIRQSVRHSLKDILMKRLTDSNLKVPEEKAAKVATKIEKELFSFFRDTDA KYKNKYRSLMFNLKDPKNNILFKKVLKGEVTPDHLIRMSPEELASKELAAWRRRSGPSSG
Solution structure of the TFIIS domain II of human PHD finger protein 3. Yoneyama, M., Tochio, N., Koshiba, S. et al. To be published.
Other PDB entries of the same protein (UniProt Q92576 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2DME directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.