6IC9: SPOC domain of human PHF3

Crystal structure of the SPOC domain of human PHF3 in complex with RNA polymerase II CTD diheptapeptide phosphorylated on Ser2Ser7. Determined by X-ray diffraction at 1.75 Å resolution. Released 15 Jul 2020.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,710
Mol. weight: 39.98 kDa
Released: 15 Jul 2020

Explore 6IC9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6IC9 contains 14 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1209-1215	7	1
β-strand	1219-1229	11	1
α-helix	1235-1238	4
β-strand	1242-1249	8	1
α-helix	1251-1264	14
β-strand	1267-1276	10	1
α-helix	1279-1295	17
β-strand	1298-1301	4	1
β-strand	1308-1316	9	1
α-helix	1320-1322	3
α-helix	1324-1326	3
α-helix	1327	1
α-helix	1329	1
β-strand	1341-1349	9	1

Chain B: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1209-1215	7	2
β-strand	1219-1229	11	2
α-helix	1235-1238	4
β-strand	1242-1249	8	2
α-helix	1251-1264	14
β-strand	1267-1276	10	2
α-helix	1279-1293	15
β-strand	1298-1301	4	2
β-strand	1308-1316	9	2
α-helix	1320-1323	4
α-helix	1324-1326	3
β-strand	1341-1349	9	2

Chains C and D: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	11-12	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PHD finger protein 3	A, B	protein	162	Homo sapiens	Q92576 (AlphaFold model)
Tyr-sep-pro-thr-ser-pro-sep-tyr-sep-pro-thr-ser-pro	C, D	protein	14	Homo sapiens	P24928 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6IC9_1 PHD finger protein 3 (chains A, B)
GAMGSTFLARLNFIWKGFINMPSVAKFVTKAYPVSGSPEYLTEDLPDSIQVGGRISPQTV
WDYVEKIKASGTKEICVVRFTPVTEEDQISYTLLFAYFSSRKRYGVAANNMKQVKDMYLI
PLGATDKIPHPLVPFDGPGLELHRPNLLLGLIIRQKLKRQHS

Sequence of entity 2 (C, D), FASTA

>6IC9_2 TYR-SEP-PRO-THR-SER-PRO-SEP-TYR-SEP-PRO-THR-SER-PRO (chains C, D)
YSPTSPSYSPTSPS

Primary citation

PHF3 regulates neuronal gene expression through the Pol II CTD reader domain SPOC. Appel, L.M., Franke, V., Bruno, M. et al. Nat Commun (2021) 12:6078. DOI 10.1038/s41467-021-26360-2

Other PDB entries of the same protein (UniProt Q92576 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6IC8 1.93 Å, Crystal structure of the SPOC domain of human PHF3 in complex with RNA polymerase II CTD…
6Q2V 2.59 Å, Crystal structure of SPOC domain of human PHD-finger protein 3 (PHF3)
6Q5Y 2.85 Å, Crystal structure of the SPOC domain of human PHF3 in complex with RNA polymerase II CTD…
2DME Solution structure of the TFIIS domain II of human PHD finger protein 3

Browse structure collections

About this viewer

MolViewer shows 6IC9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.