2DME: TFIIS domain II of human PHD finger protein 3

Solution structure of the TFIIS domain II of human PHD finger protein 3. Determined by solution NMR. Released 21 Oct 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 954
Mol. weight: 13.61 kDa
Released: 21 Oct 2006

Explore 2DME in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DME contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	9-28	20
α-helix	37-55	19
α-helix	60-69	10
α-helix	71-74	4
α-helix	81-87	7
α-helix	94-97	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PHD finger protein 3	A	protein	120	Homo sapiens	Q92576 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DME_1 PHD finger protein 3 (chains A)
GSSGSSGSADQIRQSVRHSLKDILMKRLTDSNLKVPEEKAAKVATKIEKELFSFFRDTDA
KYKNKYRSLMFNLKDPKNNILFKKVLKGEVTPDHLIRMSPEELASKELAAWRRRSGPSSG

Primary citation

Solution structure of the TFIIS domain II of human PHD finger protein 3. Yoneyama, M., Tochio, N., Koshiba, S. et al. To be published.

Other PDB entries of the same protein (UniProt Q92576 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6IC9 1.75 Å, Crystal structure of the SPOC domain of human PHF3 in complex with RNA polymerase II CTD…
6IC8 1.93 Å, Crystal structure of the SPOC domain of human PHF3 in complex with RNA polymerase II CTD…
6Q2V 2.59 Å, Crystal structure of SPOC domain of human PHD-finger protein 3 (PHF3)
6Q5Y 2.85 Å, Crystal structure of the SPOC domain of human PHF3 in complex with RNA polymerase II CTD…

Browse structure collections

About this viewer

MolViewer shows 2DME directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.