Crystal structure and binding properties of the CD2 and CD244 (2B4) binding protein, CD48. Determined by X-ray diffraction at 2.6 Å resolution. Released 4 Jul 2006.
Explore 2DRU in 3D Show helices and sheets RCSB PDB PDBe
2DRU contains 4 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-12 | 5 | 1 |
| β-strand | 17-19 | 3 | 2 |
| β-strand | 31-35 | 5 | 1 |
| β-strand | 41-45 | 5 | 1 |
| β-strand | 51-53 | 3 | 1 |
| β-strand | 62-64 | 3 | 2 |
| α-helix | 70 | 1 | |
| β-strand | 71-73 | 3 | 2 |
| α-helix | 78-80 | 3 | |
| β-strand | 82-89 | 8 | 1 |
| β-strand | 93-103 | 11 | 1 |
| α-helix | 104-106 | 3 | |
| β-strand | 110-114 | 5 | 3 |
| α-helix | 115-117 | 3 | |
| β-strand | 119-123 | 5 | 3 |
| β-strand | 131-136 | 6 | 4 |
| β-strand | 139-144 | 6 | 4 |
| β-strand | 148-152 | 5 | 3 |
| β-strand | 160-166 | 7 | 4 |
| β-strand | 169-175 | 7 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| chimera of CD48 antigen and T-cell surface antigen CD2 | A | protein | 180 | Rattus norvegicus | P08921 (AlphaFold model), P10252 (AlphaFold model) |
>2DRU_1 chimera of CD48 antigen and T-cell surface antigen CD2 (chains A) FQDQSVPNVNAITGSNVTLTILKHPLASYQRLTWLHTTNQKILEYFPNGKKTVFESVFKD RVDLDKTNGALRIYNVSKEDRGDYYMRMLHETEDQWKITMEVYEMVSKPMIYWECSNATL TCEVLEGTDVELKLYQGKEHLRSLRQKTMSYQWTNLRAPFKCKAVNRVSQESEMEVVNCP
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 3 |
Water and common crystallization additives (GOL) are not listed.
Crystal Structure and Binding Properties of the CD2 and CD244 (2B4)-binding Protein, CD48. Evans, E.J., Castro, M.A.A., O'Brien, R. et al. J Biol Chem (2006) 281:29309-29320. DOI 10.1074/jbc.M601314200 · PubMed
Other PDB entries of the same protein (UniProt P08921 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2DRU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.