2DVQ: Bromodomain-containing protein 2

Crystal structure analysis of the N-terminal bromodomain of human BRD2 complexed with acetylated histone H4 peptide. Determined by X-ray diffraction at 2.04 Å resolution. Released 7 Aug 2007.

Method: X-ray diffraction
Resolution: 2.04 Å
Organism: Homo sapiens
Chains: 5
Atoms: 3,161
Mol. weight: 47.06 kDa
Released: 7 Aug 2007

Explore 2DVQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DVQ contains 27 α-helices and 2 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	77-81	5
α-helix	82-87	6
α-helix	88-91	4
α-helix	97-99	3
α-helix	105-108	4
α-helix	113-116	4
α-helix	123-131	9
α-helix	138-155	18
α-helix	161-178	18

Chain B: 10 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	77-81	5
α-helix	82-87	6
α-helix	88-91	4
α-helix	97-99	3
α-helix	105-108	4
α-helix	113-116	4
α-helix	123-131	9
α-helix	138-155	18
β-strand	160	1	1
α-helix	161-177	17
α-helix	180-183	4

Chain C: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	77-81	5
α-helix	82-87	6
α-helix	88-92	5
α-helix	94-99	6
α-helix	113-116	4
α-helix	123-131	9
α-helix	138-155	18
α-helix	161-178	18

Chain Q: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	14	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bromodomain-containing protein 2	A, B, C	protein	122	Homo sapiens	P25440 (AlphaFold model)
histone H4	P, Q	protein	15		P02309 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>2DVQ_1 Bromodomain-containing protein 2 (chains A, B, C)
GRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLEN
NYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELVVTIP
KN

Sequence of entity 2 (P, Q), FASTA

>2DVQ_2 histone H4 (chains P, Q)
SGRGKGGKGLGKGGA

Primary citation

Structural Basis for Acetylated Histone H4 Recognition by the Human BRD2 Bromodomain. Umehara, T., Nakamura, Y., Jang, M.K. et al. J Biol Chem (2010) 285:7610-7618. DOI 10.1074/jbc.M109.062422 · PubMed

Other PDB entries of the same protein (UniProt P25440 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5IG6 0.91 Å, Ultra-high resolution crystal structure of second bromodomain of BRD2 in complex with…
5IBN 0.94 Å, Ultra high resolution crystal structure of the apo- form of second bromodomain of BRD2.
6DBC 1.05 Å, Second bromodomain of Human BRD2 with a Tetrahydroquinoline analogue
6DDJ 1.05 Å, Crystal Structure of the human BRD2 BD2 bromodimain in complex with a…
4J1P 1.08 Å, X-ray crystal structure of bromodomain 2 of human brd2 in complex with rvx208 to 1.08 A…
7VRM 1.1 Å, crystal structure of BRD2-BD2 in complex with purine derivative
6I80 1.14 Å, Crystal Structure of the second bromodomain of BRD2 in complex with RT53
7VRQ 1.15 Å, crystal structure of BRD2-BD2 in complex with purine derivative
24KK 1.2 Å, Crystal structure of the second bromodomain (BD2) of human BRD2 in complex with…
5O38 1.2 Å, Human Brd2(BD2) mutant in free form
5O3I 1.2 Å, Human Brd2(BD2) mutant in complex with AL-tBu
7USG 1.2 Å, BRD2-BD2 in complex with MDP5

Browse structure collections

About this viewer

MolViewer shows 2DVQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.