2DW3: Rhodobacter sphaeroides PufX membrane protein

Solution structure of the Rhodobacter sphaeroides PufX membrane protein. Determined by solution NMR. Released 26 Jun 2007.

Method: Solution NMR
Organism: Rhodobacter sphaeroides
Chains: 1
Atoms: 612
Mol. weight: 8.65 kDa
Released: 26 Jun 2007

Explore 2DW3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DW3 contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	14-26	13
α-helix	27-40	14
α-helix	41-52	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Intrinsic membrane protein pufX	A	protein	77	Rhodobacter sphaeroides	P13402 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DW3_1 Intrinsic membrane protein pufX (chains A)
ADKTIFNDHLNTNPKTNLRLWVAFQMMKGAGWAGGVFFGTLLLIGFFRVVGRMLPIQENQ
APAPNITGALEHHHHHH

Primary citation

Solution structure of the Rhodobacter sphaeroides PufX membrane protein: implications for the quinone exchange and protein-protein interactions. Wang, Z.Y., Suzuki, H., Kobayashi, M. et al. Biochemistry (2007) 46:3635-3642. DOI 10.1021/bi0618060 · PubMed

Other PDB entries of the same protein (UniProt P13402 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7PIL 2.5 Å, Cryo-EM structure of the Rhodobacter sphaeroides RC-LH1-PufXY monomer complex at 2.5 A
7VY3 2.63 Å, Structure of photosynthetic LH1-rc super-complex of rhodobacter sphaeroides lacking…
7VOR 2.74 Å, The structure of dimeric photosynthetic RC-LH1 supercomplex in Class-1
7VNY 2.79 Å, Rba sphaeroides WT RC-LH1 monomer
7VNM 2.86 Å, Rba sphaeroides PufY-KO RC-LH1 monomer
7VOT 2.9 Å, The structure of dimeric photosynthetic RC-LH1 supercomplex in Class-2
7F0L 2.94 Å, Structure of photosynthetic LH1-rc super-complex of rhodobacter sphaeroides monomer
7VA9 3.08 Å, Rba sphaeroides PufY-KO RC-LH1 dimer type-1
7VB9 3.45 Å, Rba sphaeroides PufY-KO RC-LH1 dimer type-2
4V9G 7.78 Å, RC-LH1-PufX dimer complex from Rhodobacter sphaeroides
2ITA Solution structure of PufX from Rhodobacter sphaeroides
2NRG Solution Structure of PufX from Rhodobacter Sphaeroides (minimised average)

Browse structure collections

About this viewer

MolViewer shows 2DW3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.