2NRG: PufX from Rhodobacter Sphaeroides

Solution Structure of PufX from Rhodobacter Sphaeroides (minimised average). Determined by solution NMR. Released 26 Dec 2006.

Method: Solution NMR
Organism: Rhodobacter sphaeroides
Chains: 1
Atoms: 638
Mol. weight: 9.06 kDa
Released: 26 Dec 2006

Explore 2NRG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2NRG contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	6-8	3
α-helix	15-27	13
α-helix	29-32	4
α-helix	34-53	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Intrinsic membrane protein pufX	A	protein	82	Rhodobacter sphaeroides	P13402 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2NRG_1 Intrinsic membrane protein pufX (chains A)
MADKTIFNDHLNTNPKTNLRLWVAFQMMKGAGWAGGVFFGTLLLIGFFRVVGRMLPIQEN
QAPAPNITGALETGIELIKHLV

Primary citation

The solution structure of the PufX polypeptide from Rhodobacter sphaeroides. Tunnicliffe, R.B., Ratcliffe, E.C., Hunter, C.N. et al. FEBS Lett (2006) 580:6967-6971. DOI 10.1016/j.febslet.2006.11.065 · PubMed

Other PDB entries of the same protein (UniProt P13402 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7PIL 2.5 Å, Cryo-EM structure of the Rhodobacter sphaeroides RC-LH1-PufXY monomer complex at 2.5 A
7VY3 2.63 Å, Structure of photosynthetic LH1-rc super-complex of rhodobacter sphaeroides lacking…
7VOR 2.74 Å, The structure of dimeric photosynthetic RC-LH1 supercomplex in Class-1
7VNY 2.79 Å, Rba sphaeroides WT RC-LH1 monomer
7VNM 2.86 Å, Rba sphaeroides PufY-KO RC-LH1 monomer
7VOT 2.9 Å, The structure of dimeric photosynthetic RC-LH1 supercomplex in Class-2
7F0L 2.94 Å, Structure of photosynthetic LH1-rc super-complex of rhodobacter sphaeroides monomer
7VA9 3.08 Å, Rba sphaeroides PufY-KO RC-LH1 dimer type-1
7VB9 3.45 Å, Rba sphaeroides PufY-KO RC-LH1 dimer type-2
4V9G 7.78 Å, RC-LH1-PufX dimer complex from Rhodobacter sphaeroides
2DW3 Solution structure of the Rhodobacter sphaeroides PufX membrane protein
2ITA Solution structure of PufX from Rhodobacter sphaeroides

Browse structure collections

About this viewer

MolViewer shows 2NRG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.