2DYT: Saccharomyces cerevisiae Atg3

The crystal structure of Saccharomyces cerevisiae Atg3. Determined by X-ray diffraction at 2.5 Å resolution. Released 23 Jan 2007.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 1,722
Mol. weight: 36.26 kDa
Released: 23 Jan 2007

Explore 2DYT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2DYT contains 10 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	22-25	4
α-helix	30-43	14
β-strand	48-49	2	1
β-strand	56	1	2
β-strand	69-76	8	1
α-helix	130-141	12
β-strand	167-176	10	1
β-strand	181-190	10	1
α-helix	194	1
β-strand	195	1	1
α-helix	196-197	2
α-helix	198-202	5
α-helix	210-213	4
β-strand	214-218	5	1
β-strand	222	1	2
β-strand	227-231	5	1
α-helix	239-264	26
α-helix	283-285	3
α-helix	286-297	12
β-strand	301	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Autophagy-related protein 3	A	protein	312	Saccharomyces cerevisiae	P40344 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2DYT_1 Autophagy-related protein 3 (chains A)
GSMIRSTLSSWREYLTPITHKSTFLTTGQITPEEFVQAGDYLCHMFPTWKWNEESSDISY
RDFLPKNKQFLIIRKVPCDKRAEQCVEVEGPDVIMKGFAEDGDEDDVLEYIGSETEHVQS
TPAGGTKDSSIDDIDELIQDMEIKEEDENDDTEEFNAKGGLAKDMAQERYYDLYIAYSTS
YRVPKMYIVGFNSNGSPLSPEQMFEDISADYRTKTATIEKLPFYKNSVLSVSIHPCKHAN
VMKILLDKVRVVRQRRRKELQEEQELDGVGDWEDLQDDIDDSLRVDQYLIVFLKFITSVT
PSIQHDYTMEGW

Primary citation

The crystal structure of Atg3, an autophagy-related ubiquitin carrier protein (E2) enzyme that mediates Atg8 lipidation. Yamada, Y., Suzuki, N.N., Hanada, T. et al. J Biol Chem (2007) 282:8036-8043. DOI 10.1074/jbc.M611473200 · PubMed

Other PDB entries of the same protein (UniProt P40344 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3T7G 2.08 Å, Atg8 transfer from Atg7 to Atg3: a distinctive E1-E2 architecture and mechanism in the…
6OJJ 2.41 Å, Structure of ScAtg3 with truncations in N-terminal and flexible region (FR)
4GSL 2.7 Å, Crystal structure of an Atg7-Atg3 crosslinked complex

Browse structure collections

About this viewer

MolViewer shows 2DYT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.