Structure of ScAtg3 with truncations in N-terminal and flexible region (FR). Determined by X-ray diffraction at 2.41 Å resolution. Released 21 Aug 2019.
Explore 6OJJ in 3D Show helices and sheets RCSB PDB PDBe
6OJJ contains 12 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 22-25 | 4 | |
| α-helix | 30-43 | 14 | |
| β-strand | 48-49 | 2 | 1 |
| α-helix | 50-52 | 3 | |
| β-strand | 56 | 1 | 2 |
| β-strand | 69-75 | 7 | 1 |
| β-strand | 167-176 | 10 | 1 |
| β-strand | 181-190 | 10 | 1 |
| α-helix | 194 | 1 | |
| β-strand | 195 | 1 | 1 |
| α-helix | 196-197 | 2 | |
| α-helix | 198-201 | 4 | |
| α-helix | 202-204 | 3 | |
| α-helix | 207-213 | 7 | |
| β-strand | 214-218 | 5 | 1 |
| β-strand | 222 | 1 | 2 |
| β-strand | 227-231 | 5 | 1 |
| α-helix | 236-255 | 20 | |
| α-helix | 281-282 | 2 | |
| α-helix | 283-285 | 3 | |
| α-helix | 286-297 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Autophagy-related protein 3,Autophagy-related protein 3 | A | protein | 220 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P40344 (AlphaFold model) |
>6OJJ_1 Autophagy-related protein 3,Autophagy-related protein 3 (chains A) GSKSTFLTTGQITPEEFVQAGDYLAHMFPTWKWNEESSDISYRDFLPKNKQFLIIRKVPA DKRAEQAVEAKDMAQERYYDLYIAYSTSYRVPKMYIVGFNSNGSPLSPEQMFEDISADYR TKTATIEKLPFYKNSVLSVSIHPCKHANVMKILLDKVRVVRQRRRKELQEEQELDGVGDW EDLQDDIDDSLRVDQYLIVFLKFITSVTPSIQHDYTMEGW
A switch element in the autophagy E2 Atg3 mediates allosteric regulation across the lipidation cascade. Zheng, Y., Qiu, Y., Grace, C.R.R. et al. Nat Commun (2019) 10:3600-3600. DOI 10.1038/s41467-019-11435-y · PubMed
Other PDB entries of the same protein (UniProt P40344 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6OJJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.