Solution structure of the cytoplasmic region of Na+/H+ exchanger 1 complexed with essential cofactor calcineurin B homologous protein 1. Determined by solution NMR. Released 19 Dec 2006.
Explore 2E30 in 3D Show helices and sheets RCSB PDB PDBe
2E30 contains 14 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 11-22 | 12 | |
| α-helix | 26-37 | 12 | |
| β-strand | 46 | 1 | 1 |
| α-helix | 48-51 | 4 | |
| α-helix | 57-59 | 3 | |
| α-helix | 64-70 | 7 | |
| β-strand | 73 | 1 | 2 |
| β-strand | 75 | 1 | 2 |
| β-strand | 78 | 1 | 1 |
| α-helix | 80-88 | 9 | |
| α-helix | 91-93 | 3 | |
| α-helix | 111-122 | 12 | |
| β-strand | 130 | 1 | 3 |
| α-helix | 132-143 | 12 | |
| α-helix | 149-163 | 15 | |
| β-strand | 171 | 1 | 3 |
| α-helix | 174-180 | 7 | |
| α-helix | 185-188 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 513-516 | 4 | |
| α-helix | 518-535 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Calcium-binding protein p22 | A | protein | 195 | Homo sapiens | Q99653 (AlphaFold model) |
| Sodium/hydrogen exchanger 1 | B | protein | 43 | Homo sapiens | P19634 (AlphaFold model) |
>2E30_1 Calcium-binding protein p22 (chains A) MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN PLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFR LYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL EKVDVEQKMSIRFLH
>2E30_2 Sodium/hydrogen exchanger 1 (chains B) VDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGHYGHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 2 |
Solution structure of the cytoplasmic region of Na+/H+ exchanger 1 complexed with essential cofactor calcineurin B homologous protein 1. Mishima, M., Wakabayashi, S., Kojima, C. J Biol Chem (2007) 282:2741-2751. DOI 10.1074/jbc.M604092200 · PubMed
Other PDB entries of the same protein (UniProt Q99653 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2E30 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.