2E31: F-box only protein 2

Name: PDB 2E31: Structural basis for selection of glycosylated substrate by SCFFbs1 ubiquitin ligase
Published: 2007-03-20
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Structural basis for selection of glycosylated substrate by SCFFbs1 ubiquitin ligase. Determined by X-ray diffraction at 2.4 Å resolution. Released 20 Mar 2007.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 3,077
Mol. weight: 52.65 kDa
Released: 20 Mar 2007

Explore 2E31 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2E31 contains 16 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	56-64	9
α-helix	68-73	6
α-helix	75-77	3
α-helix	80-86	7
α-helix	89-98	10
α-helix	114-123	10
β-strand	141-144	4	1
β-strand	151-154	4	2
α-helix	157	1
β-strand	171-174	4	2
β-strand	180-187	8	1
α-helix	195-196	2
α-helix	197-201	5
β-strand	205-212	8	2
β-strand	219-228	10	1
β-strand	234-239	6	1
β-strand	243-244	2	1
α-helix	245-246	2
β-strand	252-258	7	2
β-strand	267-276	10	1
β-strand	287-295	9	2

Chain B: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	3
β-strand	13-16	4	3
α-helix	25-28	4
β-strand	45-46	2	3
α-helix	52-62	11
α-helix	87-92	6
α-helix	97-110	14
α-helix	113-127	15
α-helix	132-139	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
F-box only protein 2	A	protein	297	Mus musculus	Q80UW2 (AlphaFold model)
S-phase kinase-associated protein 1A	B	protein	166	Homo sapiens	P63208 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2E31_1 F-box only protein 2 (chains A)
MDGDGDPESVSHPEEASPEEQPEEAGAEASAEEEQLREAEEEEEAEAVEYLAELPEPLLL
RVLAELPATELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGSADEERDHWQQFYFL
SKRRRNLLRNPCGEEDLEGWSDVEHGGDGWKVEELPGDNGVEFTQDDSVKKYFASSFEWC
RKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSENEDVLAEFAT
GQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP

Sequence of entity 2 (B), FASTA

>2E31_2 S-phase kinase-associated protein 1A (chains B)
GPHMPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKK
VIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLD
VTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK

Primary citation

Structural basis for the selection of glycosylated substrates by SCFFbs1 ubiquitin ligase. Mizushima, T., Yoshida, Y., Kumanomidou, T. et al. Proc Natl Acad Sci U S A (2007) 104:5777-5781. DOI 10.1073/pnas.0610312104 · PubMed

Other PDB entries of the same protein (UniProt Q80UW2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2RJ2 1.7 Å, Crystal Structure of the Sugar Recognizing SCF Ubiquitin Ligase at 1.7 Resolution
1UMH 2.0 Å, Structural basis of sugar-recognizing ubiquitin ligase
5B4N 2.3 Å, Structure analysis of function associated loop mutant of substrate recognition domain of…
1UMI 2.4 Å, Structural basis of sugar-recognizing ubiquitin ligase
2E33 2.7 Å, Structural basis for selection of glycosylated substrate by SCFFbs1 ubiquitin ligase
2E32 3.52 Å, Structural basis for selection of glycosylated substrate by SCFFbs1 ubiquitin ligase

Browse structure collections

About this viewer

MolViewer shows 2E31 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.