2E33: F-box only protein 2

Structural basis for selection of glycosylated substrate by SCFFbs1 ubiquitin ligase. Determined by X-ray diffraction at 2.7 Å resolution. Released 20 Mar 2007.

Method: X-ray diffraction
Resolution: 2.7 Å
Organisms: Mus musculus, Bos taurus
Chains: 2
Atoms: 2,423
Mol. weight: 37.21 kDa
Released: 20 Mar 2007

Explore 2E33 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2E33 contains 5 α-helices and 21 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	141-144	4	1
β-strand	151-154	4	2
β-strand	171-174	4	2
β-strand	180-187	8	1
α-helix	195-200	6
β-strand	204-212	9	2
β-strand	219-228	10	1
β-strand	234-239	6	1
β-strand	243-244	2	1
β-strand	252-258	7	2
β-strand	267-276	10	1
β-strand	287-296	10	2

Chain B: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	6-12	7
β-strand	13	1	3
α-helix	25-32	8
β-strand	43-47	5	3
α-helix	51-55	5
α-helix	56-59	4
β-strand	62-63	2	4
β-strand	72-74	3	4
β-strand	79-86	8	3
β-strand	91	1	5
β-strand	94	1	5
β-strand	97-104	8	3
β-strand	106-111	6	4
β-strand	116-123	8	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
F-box only protein 2	A	protein	197	Mus musculus	Q80UW2 (AlphaFold model)
Ribonuclease pancreatic	B	protein	124	Bos taurus	P61823 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2E33_1 F-box only protein 2 (chains A)
GSHMGSADEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWSDVEHGGDGWKVEELPGDNG
VEFTQDDSVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSL
YELTVRLLSENEDVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYW
KGWFGARVTNSSVWVEP

Sequence of entity 2 (B), FASTA

>2E33_2 Ribonuclease pancreatic (chains B)
KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQ
KNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHF
DASV

Primary citation

Structural basis for the selection of glycosylated substrates by SCFFbs1 ubiquitin ligase. Mizushima, T., Yoshida, Y., Kumanomidou, T. et al. Proc Natl Acad Sci U S A (2007) 104:5777-5781. DOI 10.1073/pnas.0610312104 · PubMed

Other PDB entries of the same protein (UniProt Q80UW2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2RJ2 1.7 Å, Crystal Structure of the Sugar Recognizing SCF Ubiquitin Ligase at 1.7 Resolution
1UMH 2.0 Å, Structural basis of sugar-recognizing ubiquitin ligase
5B4N 2.3 Å, Structure analysis of function associated loop mutant of substrate recognition domain of…
1UMI 2.4 Å, Structural basis of sugar-recognizing ubiquitin ligase
2E31 2.4 Å, Structural basis for selection of glycosylated substrate by SCFFbs1 ubiquitin ligase
2E32 3.52 Å, Structural basis for selection of glycosylated substrate by SCFFbs1 ubiquitin ligase

Browse structure collections

About this viewer

MolViewer shows 2E33 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.