2E3K: Human Brd2 second bromodomain in

Crystal structure of the human Brd2 second bromodomain in complexed with the acetylated histone H4 peptide. Determined by X-ray diffraction at 2.3 Å resolution. Released 11 Dec 2007.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 6
Atoms: 4,178
Mol. weight: 55.48 kDa
Released: 11 Dec 2007

Explore 2E3K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2E3K contains 36 α-helices and 2 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	349-361	13
α-helix	363-365	3
α-helix	366-369	4
α-helix	370-372	3
α-helix	378-381	4
α-helix	386-389	4
α-helix	396-404	9
α-helix	411-428	18
α-helix	434-451	18

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	348-360	13
α-helix	363-365	3
α-helix	366-369	4
α-helix	370-372	3
α-helix	379-381	3
α-helix	386-389	4
α-helix	396-404	9
α-helix	411-428	18
α-helix	434-451	18

Chain C: 9 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	350-361	12
α-helix	363-365	3
α-helix	366-369	4
α-helix	370-372	3
α-helix	378-381	4
α-helix	386-389	4
α-helix	396-404	9
α-helix	411-428	18
β-strand	433	1	1
α-helix	434-451	18

Chain D: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	348-361	14
α-helix	363-365	3
α-helix	366-369	4
α-helix	370-372	3
α-helix	378-381	4
α-helix	386-389	4
α-helix	396-404	9
α-helix	411-428	18
α-helix	434-451	18

Chain Q: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	8	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bromodomain-containing protein 2	A, B, C, D	protein	112	Homo sapiens	P25440 (AlphaFold model)
15-mer peptide from Histone H4	Q, R	protein	15		P02309 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>2E3K_1 Bromodomain-containing protein 2 (chains A, B, C, D)
GSHMEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKM
ENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD

Sequence of entity 2 (Q, R), FASTA

>2E3K_2 15-mer peptide from Histone H4 (chains Q, R)
SGRGKGGKGLGKGGA

Primary citation

Structural basis for diacetylated histone H4 tail recognition by the second bromodomain of human BRD2. Padmanabhan, B., Umehara, T., Nakano, K. et al. To be published.

Other PDB entries of the same protein (UniProt P25440 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5IG6 0.91 Å, Ultra-high resolution crystal structure of second bromodomain of BRD2 in complex with…
5IBN 0.94 Å, Ultra high resolution crystal structure of the apo- form of second bromodomain of BRD2.
6DBC 1.05 Å, Second bromodomain of Human BRD2 with a Tetrahydroquinoline analogue
6DDJ 1.05 Å, Crystal Structure of the human BRD2 BD2 bromodimain in complex with a…
4J1P 1.08 Å, X-ray crystal structure of bromodomain 2 of human brd2 in complex with rvx208 to 1.08 A…
7VRM 1.1 Å, crystal structure of BRD2-BD2 in complex with purine derivative
6I80 1.14 Å, Crystal Structure of the second bromodomain of BRD2 in complex with RT53
7VRQ 1.15 Å, crystal structure of BRD2-BD2 in complex with purine derivative
24KK 1.2 Å, Crystal structure of the second bromodomain (BD2) of human BRD2 in complex with…
5O38 1.2 Å, Human Brd2(BD2) mutant in free form
5O3I 1.2 Å, Human Brd2(BD2) mutant in complex with AL-tBu
7USG 1.2 Å, BRD2-BD2 in complex with MDP5

Browse structure collections

About this viewer

MolViewer shows 2E3K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.