Solution structure of the ELL_N2 domain of target of RNA polymerase II elongation factor ELL2. Determined by solution NMR. Released 26 Jun 2007.
Explore 2E5N in 3D Show helices and sheets RCSB PDB PDBe
2E5N contains 5 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 14-24 | 11 | |
| β-strand | 27 | 1 | 1 |
| α-helix | 29-39 | 11 | |
| α-helix | 43-56 | 14 | |
| β-strand | 57-60 | 4 | 1 |
| β-strand | 65-68 | 4 | 1 |
| α-helix | 72-75 | 4 | |
| α-helix | 87-98 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| RNA polymerase II elongation factor ELL2 | A | protein | 100 | Homo sapiens | O00472 (AlphaFold model) |
>2E5N_1 RNA polymerase II elongation factor ELL2 (chains A) GSSGSSGTISQRPYRDRVIHLLALKAYKKPELLARLQKDGVNQKDKNSLGAILQQVANLN SKDLSYTLKDYVFKELQRDWPGYSEIDRRSLESVLSRKLN
Solution structure of the ELL_N2 domain of target of RNA polymerase II elongation factor ELL2. Dang, W., Muto, Y., Inoue, M. et al. To be published.
Other PDB entries of the same protein (UniProt O00472 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2E5N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.