5JW9: ELL2 Oclludin Domain and AFF4 peptide

The Crystal Structure of ELL2 Oclludin Domain and AFF4 peptide. Determined by X-ray diffraction at 2.0 Å resolution. Released 8 Feb 2017.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,400
Mol. weight: 21.55 kDa
Released: 8 Feb 2017

Explore 5JW9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5JW9 contains 6 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	15-23	9
α-helix	25-33	9

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	527-531	5
α-helix	538-578	41
α-helix	584-602	19
α-helix	607-636	30

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AF4/FMR2 family member 4	A	protein	64	Homo sapiens	Q9UHB7 (AlphaFold model)
RNA polymerase II elongation factor ELL2	B	protein	122	Homo sapiens	O00472 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5JW9_1 AF4/FMR2 family member 4 (chains A)
GAMGSPSQPLDASASGDVSCVDEILKEMTHSWPPPLTAIHTPCKTEPSKFPFPTKEGSGS
GSGS

Sequence of entity 2 (B), FASTA

>5JW9_2 RNA polymerase II elongation factor ELL2 (chains B)
EPSAIELPDYLIKYIAIVSYEQRQNYKDDFNAEYDEYRALHARMETVARRFIKLDAQRKR
LSPGSKEYQNVHEEVLQEYQKIKQSSPNYHEEKYRCEYLHNKLAHIKRMIGEFDQQQAES
WS

Primary citation

Structural basis for ELL2 and AFF4 activation of HIV-1 proviral transcription. Qi, S., Li, Z., Schulze-Gahmen, U. et al. Nat Commun (2017) 8:14076-14076. DOI 10.1038/ncomms14076 · PubMed

Other PDB entries of the same protein (UniProt Q9UHB7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KN5 2.2 Å, Crystal structure of AFF4 C-terminal domain
6R80 2.2 Å, Structure of AFF4 C-terminal homology domain
6K7P 2.4 Å, Crystal structure of human AFF4-THD domain
4OR5 2.9 Å, Crystal structure of HIV-1 Tat complexed with human P-TEFb and AFF4
4IMY 2.94 Å, The AFF4 scaffold binds human P-TEFb adjacent to HIV Tat
4OGR 3.0 Å, crystal structure of P-TEFb complex with AFF4 and Tat
6CYT 3.5 Å, HIV-1 TAR loop in complex with Tat:AFF4:P-TEFb
5L1Z 5.9 Å, TAR complex with HIV-1 Tat-AFF4-P-TEFb

Browse structure collections

About this viewer

MolViewer shows 5JW9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.