Solution structure of the TUDOR domain of PHD finger protein 19, isoform b [Homo sapiens]. Determined by solution NMR. Released 26 Jun 2007.
Explore 2E5Q in 3D Show helices and sheets RCSB PDB PDBe
2E5Q contains 1 α-helix and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 13-17 | 5 | 1 |
| β-strand | 23-28 | 6 | 1 |
| β-strand | 37-42 | 6 | 1 |
| β-strand | 47-51 | 5 | 1 |
| α-helix | 52-54 | 3 | |
| β-strand | 55-56 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| PHD finger protein 19 | A | protein | 63 | Homo sapiens | Q5T6S3 (AlphaFold model) |
>2E5Q_1 PHD finger protein 19 (chains A) GSSGSSGLTEGQYVLCRWTDGLYYLGKIKRVSSSKQSCLVTFEDNSKYWVLWKDIQHAGV PGE
Solution structure of the TUDOR domain of PHD finger protein 19, isoform b [Homo sapiens]. Dang, W., Muto, Y., Inoue, M. et al. To be published.
Other PDB entries of the same protein (UniProt Q5T6S3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2E5Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.