Solution structure of the TUDOR domain of Staphylococcal nuclease domain-containing protein 1. Determined by solution NMR. Released 3 Jul 2007.
Explore 2E6N in 3D Show helices and sheets RCSB PDB PDBe
2E6N contains 3 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-24 | 15 | |
| α-helix | 26-28 | 3 | |
| β-strand | 39-44 | 6 | 1 |
| β-strand | 48-59 | 12 | 1 |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 72-76 | 5 | 1 |
| β-strand | 81-82 | 2 | 1 |
| α-helix | 100-103 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Staphylococcal nuclease domain-containing protein 1 | A | protein | 104 | Homo sapiens | Q7KZF4 (AlphaFold model) |
>2E6N_1 Staphylococcal nuclease domain-containing protein 1 (chains A) GSSGSSGGTQLEKLMENMRNDIASHPPVEGSYAPRRGEFCIAKFVDGEWYRARVEKVESP AKIHVFYIDYGNREVLPSTRLGTLSPAFSTRVLPAQATEYAFAF
Solution structure of the TUDOR domain of Staphylococcal nuclease domain-containing protein 1. Dang, W., Muto, Y., Inoue, M. et al. To be published.
Other PDB entries of the same protein (UniProt Q7KZF4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2E6N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.