2E74: Cytochrome b6f Complex from M.laminosus
Crystal Structure of the Cytochrome b6f Complex from M.laminosus. Determined by X-ray diffraction at 3.0 Å resolution. Released 12 Jun 2007.
- Method
- X-ray diffraction
- Resolution
- 3.0 Å
- Organism
- Mastigocladus laminosus
- Chains
- 8
- Atoms
- 8,025
- Mol. weight
- 116.34 kDa
- Ligands
- CD, HEM, HEC, UMQ
- Released
- 12 Jun 2007
Explore 2E74 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
2E74 contains 40 α-helices and 33 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 14 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-12 | 9 | |
| α-helix | 14-21 | 8 | |
| β-strand | 25-26 | 2 | 1 |
| α-helix | 32-35 | 4 | |
| α-helix | 36-55 | 20 | |
| α-helix | 65-74 | 10 | |
| α-helix | 79-105 | 27 | |
| α-helix | 112-114 | 3 | |
| α-helix | 115-135 | 21 | |
| β-strand | 141 | 1 | 2 |
| α-helix | 142-151 | 10 | |
| α-helix | 154-157 | 4 | |
| α-helix | 162-170 | 9 | |
| α-helix | 177-185 | 9 | |
| α-helix | 186-190 | 5 | |
| α-helix | 191-209 | 19 | |
Chain B: 8 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 5 | 1 | 3 |
| α-helix | 12-20 | 9 | |
| β-strand | 28 | 1 | 3 |
| β-strand | 29-30 | 2 | 1 |
| α-helix | 32-35 | 4 | |
| α-helix | 39-57 | 19 | |
| β-strand | 65 | 1 | 2 |
| α-helix | 79-81 | 3 | |
| α-helix | 82-89 | 8 | |
| α-helix | 94-114 | 21 | |
| α-helix | 115-117 | 3 | |
| α-helix | 127-146 | 20 | |
Chain C: 6 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-8 | 7 | |
| α-helix | 21-24 | 4 | |
| β-strand | 33-35 | 3 | 4 |
| β-strand | 39-40 | 2 | 5 |
| β-strand | 45-51 | 7 | 4 |
| β-strand | 71-77 | 7 | 5 |
| α-helix | 78-79 | 2 | |
| β-strand | 83-84 | 2 | 4 |
| α-helix | 87-89 | 3 | |
| α-helix | 92-98 | 7 | |
| β-strand | 104-105 | 2 | 5 |
| β-strand | 113-120 | 8 | 5 |
| β-strand | 126-132 | 7 | 4 |
| β-strand | 145-155 | 11 | 5 |
| β-strand | 160 | 1 | 6 |
| β-strand | 166 | 1 | 6 |
| β-strand | 183-186 | 4 | 7 |
| β-strand | 194-198 | 5 | 7 |
| β-strand | 208-210 | 3 | 7 |
| β-strand | 239-249 | 11 | 5 |
| α-helix | 252-287 | 36 | |
Chain D: 7 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 13-42 | 30 | |
| α-helix | 44-46 | 3 | |
| β-strand | 55 | 1 | 8 |
| α-helix | 66-71 | 6 | |
| β-strand | 79-82 | 4 | 8 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-91 | 4 | 8 |
| β-strand | 102-105 | 4 | 8 |
| β-strand | 107 | 1 | 9 |
| α-helix | 113 | 1 | |
| β-strand | 114 | 1 | 9 |
| α-helix | 115-116 | 2 | |
| β-strand | 117 | 1 | 10 |
| β-strand | 124-126 | 3 | 10 |
| β-strand | 131-133 | 3 | 10 |
| β-strand | 139 | 1 | 10 |
| α-helix | 147-149 | 3 | |
| β-strand | 150-154 | 5 | 8 |
| β-strand | 161-164 | 4 | 8 |
Chain E: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-26 | 25 | |
| α-helix | 27-31 | 5 | |
Chain F: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-30 | 28 | |
Chain G: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-28 | 25 | |
Chain H: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-25 | 23 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Cytochrome b6 | A | protein | 215 | Mastigocladus laminosus | P83791 (AlphaFold model) |
| Cytochrome b6-f complex subunit 4 | B | protein | 160 | Mastigocladus laminosus | P83792 (AlphaFold model) |
| Apocytochrome f | C | protein | 289 | Mastigocladus laminosus | P83793 (AlphaFold model) |
| Cytochrome b6-f complex iron-sulfur subunit | D | protein | 179 | Mastigocladus laminosus | P83794 (AlphaFold model) |
| Cytochrome b6-f complex subunit 6 | E | protein | 32 | Mastigocladus laminosus | P83795 |
| Cytochrome b6-f complex subunit 7 | F | protein | 35 | Mastigocladus laminosus | P83796 |
| Cytochrome b6-f complex subunit 5 | G | protein | 37 | Mastigocladus laminosus | P83797 |
| Cytochrome b6-f complex subunit 8 | H | protein | 29 | Mastigocladus laminosus | P83798 |
Sequence of entity 1 (A), FASTA
>2E74_1 Cytochrome b6 (chains A)
MANVYDWFQERLEIQALADDVTSKYVPPHVNIFYCLGGITLTCFLIQFATGFAMTFYYKP
TVTEAYASVQYIMNEVSFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWIS
GVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGVLISDLLRGGSSVGQATL
TRYYSAHTFVLPWLIAVFMLLHFLMIRKQGISGPL
Sequence of entity 2 (B), FASTA
>2E74_2 Cytochrome b6-f complex subunit 4 (chains B)
MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPA
MVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKF
QNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Sequence of entity 3 (C), FASTA
>2E74_3 Apocytochrome f (chains C)
YPFWAQQTYPPTPREPTGRIVCANCHLAAKPAEVEVPQSVLPDTVFKAVVKIPYDTKLQQ
VAADGSKVGLNVGAVLMLPEGFKIAPEERIPEELKKEVGDVYFQPYKEGQDNVLLVGPLP
GEQYQEIVFPVLSPNPTTDKNIHFGKYAIHLGANRGRGQIYPTGEKSNNNVFTASATGTI
TKIAKEEDEYGNVKYQVSIQTDSGKTVVDTIPAGPELIVSEGQAVKAGEALTNNPNVGGF
GQDDTEIVLQDPNRVKWMIAFICLVMLAQLMLILKKKQVEKVQAAEMNF
Sequence of entity 4 (D), FASTA
>2E74_4 Cytochrome b6-f complex iron-sulfur subunit (chains D)
MAQFTESMDVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVGGGTTAKDKL
GNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVVESKEAIRDYGINAVCTHLGCVVPWNAA
ENKFKCPCHGSQYDETGKVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV
Sequence of entity 5 (E), FASTA
>2E74_5 Cytochrome b6-f complex subunit 6 (chains E)
MILGAVFYIVFIALFFGIAVGIIFAIKSIKLI
Sequence of entity 6 (F), FASTA
>2E74_6 Cytochrome b6-f complex subunit 7 (chains F)
MTEEMLYAALLSFGLIFVGWGLGVLLLKIQGAEKE
Sequence of entity 7 (G), FASTA
>2E74_7 Cytochrome b6-f complex subunit 5 (chains G)
MVEPLLDGLVLGLVFATLGGLFYAAYQQYKRPNELGG
Sequence of entity 8 (H), FASTA
>2E74_8 Cytochrome b6-f complex subunit 8 (chains H)
MEIDVLGWVALLVVFTWSIAMVVWGRNGL
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| CD | Cadmium ion | Cd | 2 |
| HEM | Protoporphyrin IX containing FE | C34 H32 Fe N4 O4 | 2 |
| HEC | Heme C | C34 H36 Fe N4 O4 | 2 |
| UMQ | Undecyl-maltoside | C23 H44 O11 | 4 |
| CLA | Chlorophyll a | C55 H72 Mg N4 O5 | 1 |
| OPC | (7R,17E)-4-hydroxy-N,N,N,7-tetramethyl-7-[(8E)-octadec-8-enoyloxy]-10-oxo-3,5,9… | C45 H87 N O8 P | 2 |
| FES | FE2/S2 (inorganic) cluster | Fe2 S2 | 1 |
| SQD | 1,2-di-O-acyl-3-O-[6-deoxy-6-sulfo-alpha-D-glucopyranosyl]-sn-glycerol | C41 H78 O12 S | 1 |
| BCR | Beta-carotene | C40 H56 | 1 |
Primary citation
Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n). Yamashita, E., Zhang, H., Cramer, W.A. J Mol Biol (2007) 370:39-52. DOI 10.1016/j.jmb.2007.04.011 · PubMed
Other PDB entries of the same protein (UniProt P83791 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 4I7Z 2.8 Å, Crystal structure of cytochrome b6f in DOPG, with disordered Rieske Iron-Sulfur Protein…
- 1VF5 3.0 Å, Crystal Structure of Cytochrome b6f Complex from M.laminosus
- 4PV1 3.0 Å, Cytochrome B6F structure from M. laminosus with the quinone analog inhibitor stigmatellin
- 4H13 3.07 Å, Crystal Structure of the Cytochrome b6f Complex from Mastigocladus laminosus with TDS
- 4H0L 3.25 Å, Cytochrome b6f Complex Crystal Structure from Mastigocladus laminosus with n-Side…
- 2E76 3.41 Å, Crystal Structure of the Cytochrome b6f Complex with tridecyl-stigmatellin (TDS) from…
- 2E75 3.55 Å, Crystal Structure of the Cytochrome b6f Complex with 2-nonyl-4-hydroxyquinoline N-oxide…
- 2D2C 3.8 Å, Crystal Structure Of Cytochrome B6F Complex with DBMIB From M. Laminosus
Browse structure collections
About this viewer
MolViewer shows 2E74 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.