4I7Z: Cytochrome b6
Crystal structure of cytochrome b6f in DOPG, with disordered Rieske Iron-Sulfur Protein soluble domain. Determined by X-ray diffraction at 2.8 Å resolution. Released 17 Apr 2013.
- Method
- X-ray diffraction
- Resolution
- 2.8 Å
- Organism
- Mastigocladus laminosus
- Chains
- 8
- Atoms
- 6,959
- Mol. weight
- 116.43 kDa
- Ligands
- MYS, 8K6, CD, CLA
- Released
- 17 Apr 2013
Explore 4I7Z in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4I7Z contains 41 α-helices and 25 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 13 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-12 | 9 | |
| α-helix | 15-23 | 9 | |
| β-strand | 25-26 | 2 | 1 |
| α-helix | 32-35 | 4 | |
| α-helix | 36-54 | 19 | |
| α-helix | 65-74 | 10 | |
| α-helix | 79-105 | 27 | |
| α-helix | 115-136 | 22 | |
| β-strand | 141 | 1 | 2 |
| α-helix | 142-151 | 10 | |
| α-helix | 154-157 | 4 | |
| α-helix | 162-170 | 9 | |
| α-helix | 177-185 | 9 | |
| α-helix | 186-190 | 5 | |
| α-helix | 191-209 | 19 | |
Chain B: 14 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 5 | 1 | 3 |
| α-helix | 12-19 | 8 | |
| β-strand | 28 | 1 | 3 |
| β-strand | 29-30 | 2 | 1 |
| α-helix | 31-35 | 5 | |
| α-helix | 40-57 | 18 | |
| α-helix | 59-61 | 3 | |
| α-helix | 64 | 1 | |
| β-strand | 65 | 1 | 2 |
| α-helix | 66 | 1 | |
| α-helix | 71-72 | 2 | |
| α-helix | 79-81 | 3 | |
| α-helix | 82-90 | 9 | |
| α-helix | 94-114 | 21 | |
| α-helix | 115-117 | 3 | |
| α-helix | 123-125 | 3 | |
| α-helix | 127-148 | 22 | |
| α-helix | 151-153 | 3 | |
Chain C: 7 helices, 19 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-8 | 7 | |
| α-helix | 21-24 | 4 | |
| β-strand | 29 | 1 | 4 |
| β-strand | 33-35 | 3 | 5 |
| β-strand | 39-40 | 2 | 4 |
| β-strand | 45-51 | 7 | 5 |
| β-strand | 60-61 | 2 | 6 |
| β-strand | 67-68 | 2 | 6 |
| β-strand | 71-77 | 7 | 4 |
| α-helix | 78-79 | 2 | |
| β-strand | 83-84 | 2 | 5 |
| α-helix | 85-86 | 2 | |
| α-helix | 87-89 | 3 | |
| α-helix | 92-98 | 7 | |
| β-strand | 104-105 | 2 | 4 |
| β-strand | 113-120 | 8 | 4 |
| β-strand | 126-132 | 7 | 5 |
| β-strand | 145-155 | 11 | 4 |
| β-strand | 160 | 1 | 7 |
| β-strand | 166 | 1 | 7 |
| β-strand | 194-195 | 2 | 8 |
| β-strand | 198 | 1 | 9 |
| β-strand | 208 | 1 | 9 |
| β-strand | 211-212 | 2 | 8 |
| β-strand | 239-249 | 11 | 4 |
| α-helix | 252-284 | 33 | |
Chain D: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 13-42 | 30 | |
| α-helix | 44-45 | 2 | |
Chain E: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-27 | 25 | |
Chain F: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-30 | 27 | |
Chain G: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-30 | 27 | |
| α-helix | 32-33 | 2 | |
Chain H: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-26 | 24 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Cytochrome b6 | A | protein | 215 | Mastigocladus laminosus | P83791 (AlphaFold model) |
| Cytochrome b6-f complex subunit 4 | B | protein | 160 | Mastigocladus laminosus | P83792 (AlphaFold model) |
| Apocytochrome f | C | protein | 289 | Mastigocladus laminosus | P83793 (AlphaFold model) |
| Cytochrome b6-f complex iron-sulfur subunit | D | protein | 179 | Mastigocladus laminosus | P83794 (AlphaFold model) |
| Cytochrome b6-f complex subunit 6 | E | protein | 32 | Mastigocladus laminosus | P83795 |
| Cytochrome b6-f complex subunit 7 | F | protein | 35 | Mastigocladus laminosus | P83796 |
| Cytochrome b6-f complex subunit 5 | G | protein | 37 | Mastigocladus laminosus | P83797 |
| Cytochrome b6-f complex subunit 8 | H | protein | 29 | Mastigocladus laminosus | P83798 |
Sequence of entity 1 (A), FASTA
>4I7Z_1 Cytochrome b6 (chains A)
MANVYDWFQERLEIQALADDVTSKYVPPHVNIFYCLGGITLTCFLIQFATGFAMTFYYKP
TVTEAYASVQYIMNEVSFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWIS
GVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGVLISDLLRGGSSVGQATL
TRYYSAHTFVLPWLIAVFMLLHFLMIRKQGISGPL
Sequence of entity 2 (B), FASTA
>4I7Z_2 Cytochrome b6-f complex subunit 4 (chains B)
MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPA
MVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKF
QNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Sequence of entity 3 (C), FASTA
>4I7Z_3 Apocytochrome f (chains C)
YPFWAQQTYPPTPREPTGRIVCANCHLAAKPAEVEVPQSVLPDTVFKAVVKIPYDTKLQQ
VAADGSKVGLNVGAVLMLPEGFKIAPEERIPEELKKEVGDVYFQPYKEGQDNVLLVGPLP
GEQYQEIVFPVLSPNPTTDKNIHFGKYAIHLGANRGRGQIYPTGEKSNNNVFTASATGTI
TKIAKEEDEYGNVKYQVSIQTDSGKTVVDTIPAGPELIVSEGQAVKAGEALTNNPNVGGF
GQDDTEIVLQDPNRVKWMIAFICLVMLAQLMLILKKKQVEKVQAAEMNF
Sequence of entity 4 (D), FASTA
>4I7Z_4 Cytochrome b6-f complex iron-sulfur subunit (chains D)
MAQFTESMDVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVGGGTTAKDKL
GNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVVESKEAIRDYGINAVCTHLGCVVPWNAA
ENKFKCPCHGSQYDETGKVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV
Sequence of entity 5 (E), FASTA
>4I7Z_5 Cytochrome b6-f complex subunit 6 (chains E)
MILGAVFYIVFIALFFGIAVGIIFAIKSIKLI
Sequence of entity 6 (F), FASTA
>4I7Z_6 Cytochrome b6-f complex subunit 7 (chains F)
MTEEMLYAALLSFGLIFVGWGLGVLLLKIQGAEKE
Sequence of entity 7 (G), FASTA
>4I7Z_7 Cytochrome b6-f complex subunit 5 (chains G)
MVEPLLDGLVLGLVFATLGGLFYAAYQQYKRPNELGG
Sequence of entity 8 (H), FASTA
>4I7Z_8 Cytochrome b6-f complex subunit 8 (chains H)
MEIDVLGWVALLVVFTWSIAMVVWGRNGL
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| MYS | Pentadecane | C15 H32 | 1 |
| 8K6 | Octadecane | C18 H38 | 1 |
| CD | Cadmium ion | Cd | 3 |
| CLA | Chlorophyll a | C55 H72 Mg N4 O5 | 1 |
| OZ2 | (2R)-3-{[(R)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-2-[(6Z)-tr… | C37 H69 O10 P | 3 |
| 1E2 | (2S)-3-(acetyloxy)-2-hydroxypropyl 6-deoxy-6-sulfo-beta-D-glucopyranoside | C11 H20 O11 S | 1 |
| BCR | Beta-carotene | C40 H56 | 1 |
| HEM | Protoporphyrin IX containing FE | C34 H32 Fe N4 O4 | 4 |
| OCT | N-octane | C8 H18 | 1 |
| UMQ | Undecyl-maltoside | C23 H44 O11 | 3 |
Primary citation
Lipid-induced conformational changes within the cytochrome b6f complex of oxygenic photosynthesis. Hasan, S.S., Stofleth, J.T., Yamashita, E. et al. Biochemistry (2013) 52:2649-2654. DOI 10.1021/bi301638h · PubMed
Other PDB entries of the same protein (UniProt P83791 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1VF5 3.0 Å, Crystal Structure of Cytochrome b6f Complex from M.laminosus
- 2E74 3.0 Å, Crystal Structure of the Cytochrome b6f Complex from M.laminosus
- 4PV1 3.0 Å, Cytochrome B6F structure from M. laminosus with the quinone analog inhibitor stigmatellin
- 4H13 3.07 Å, Crystal Structure of the Cytochrome b6f Complex from Mastigocladus laminosus with TDS
- 4H0L 3.25 Å, Cytochrome b6f Complex Crystal Structure from Mastigocladus laminosus with n-Side…
- 2E76 3.41 Å, Crystal Structure of the Cytochrome b6f Complex with tridecyl-stigmatellin (TDS) from…
- 2E75 3.55 Å, Crystal Structure of the Cytochrome b6f Complex with 2-nonyl-4-hydroxyquinoline N-oxide…
- 2D2C 3.8 Å, Crystal Structure Of Cytochrome B6F Complex with DBMIB From M. Laminosus
Browse structure collections
About this viewer
MolViewer shows 4I7Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.