2ECL: RING domain of the human RING-box protein 2

Solution Structure of the RING domain of the human RING-box protein 2. Determined by solution NMR. Released 14 Aug 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 638
Mol. weight: 9.44 kDa
Ligands: ZN
Released: 14 Aug 2007

Explore 2ECL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ECL contains 2 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	18	1	1
β-strand	23	1	1
α-helix	32-35	4
β-strand	43-46	4	2
β-strand	51-53	3	2
α-helix	54-60	7
β-strand	66	1	3
β-strand	73	1	3
β-strand	76-80	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RING-box protein 2	A	protein	81	Homo sapiens	Q9UBF6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2ECL_1 RING-box protein 2 (chains A)
GSSGSSGMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLW
VKQNNRCPLCQQDWVVQRIGK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3

Primary citation

Solution Structure of the RING domain of the human RING-box protein 2. Miyamoto, K., Tomizawa, T., Koshiba, S. et al. To be published.

Other PDB entries of the same protein (UniProt Q9UBF6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9T7V 2.95 Å, Structure of LRRC58-EloB/C-CDO1 in complex with NEDD8-CUL5-RBX2-ARIH2-Ub
9SDX 2.97 Å, Structure of RBR binding E2 variant crosslinked with NEDD8-CUL5-RBX2 bound ARIH2 and Ub
9SDY 3.06 Å, Structure of RBR E2 variant binding to CUL5-RBX2 bound ARIH2
7ONI 3.4 Å, Structure of Neddylated CUL5 C-terminal region-RBX2-ARIH2*
9EG1 3.52 Å, COP9 signalosome deneddylation complex with cullin-5
9OMA 4.14 Å, Cryo-EM structure of PCMTD1-ELOBC-CUL5-RBX2 (CRL5-PCMTD1)
9A1I Integrative structure determination of the A3G-CRL5-Vif complex (rigid)
9A1J Integrative structure determination of the A3G-CRL5-Vif complex (flexible)

Browse structure collections

About this viewer

MolViewer shows 2ECL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.