2ECY: TNF receptor-associated factor 3

Solution structure of the Zinc finger, C3HC4 type (RING finger)" domain of TNF receptor-associated factor 3. Determined by solution NMR. Released 26 Feb 2008.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 492
Mol. weight: 7.27 kDa
Ligands: ZN
Released: 26 Feb 2008

Explore 2ECY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ECY contains 1 α-helix and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	16-17	2	1
β-strand	24-25	2	1
α-helix	39-46	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TNF receptor-associated factor 3	A	protein	66	Homo sapiens	Q13114 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2ECY_1 TNF receptor-associated factor 3 (chains A)
GSSGSSGFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESI
VKDKVF

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Solution structure of the Zinc finger, C3HC4 type (RING finger)" domain of TNF receptor-associated factor 3. Abe, H., Miyamoto, K., Tochio, N. et al. To be published.

Other PDB entries of the same protein (UniProt Q13114 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8T5P 2.5 Å, SARS-CoV-2 ORF3a peptide in complex with TRAF3 TRAF domain
2GKW 2.7 Å, Key contacts promote recongnito of BAFF-R by TRAF3
1FLK 2.8 Å, Molecular basis for CD40 signaling mediated by TRAF3
1ZMS 2.8 Å, LMP1 Protein binds to TRAF3 as a structural CD40
8ZUK 2.83 Å, Cluster structure of the BAFF-BAFFR-TRAF3 complex
1L0A 2.9 Å, Downstream regulator tank binds to the CD40 recognition site on TRAF3
1FLL 3.5 Å, Molecular basis for CD40 signaling mediated by TRAF3
1KZZ 3.5 Å, Downstream regulator tank binds to the CD40 recognition site on TRAF3
1RF3 3.5 Å, Structurally Distinct Recognition Motifs in Lymphotoxin-B Receptor and CD40 for…

Browse structure collections

About this viewer

MolViewer shows 2ECY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.