Solution structures of the fn3 domain of human contactin 1. Determined by solution NMR. Released 21 Aug 2007.
Explore 2EE2 in 3D Show helices and sheets RCSB PDB PDBe
2EE2 contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 26-31 | 6 | 1 |
| β-strand | 34-38 | 5 | 1 |
| α-helix | 40-42 | 3 | |
| β-strand | 49-56 | 8 | 2 |
| α-helix | 61-63 | 3 | |
| β-strand | 65-70 | 6 | 2 |
| β-strand | 75-78 | 4 | 1 |
| β-strand | 86-94 | 9 | 2 |
| β-strand | 106-109 | 4 | 2 |
| α-helix | 110-114 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Contactin-1 | A | protein | 119 | Homo sapiens | Q12860 (AlphaFold model) |
>2EE2_1 Contactin-1 (chains A) GSSGSSGVAVINSAQDAPSEAPTEVGVKVLSSSEISVHWEHVLEKIVESYQIRYWAAHDK EEAANRVQVTSQEYSARLENLLPDTQYFIEVGACNSAGCGPPSDMIEAFTKKASGPSSG
Solution structures of the fn3 domain of human contactin 1. Sato, M., Tochio, N., Koshiba, S. et al. To be published.
Other PDB entries of the same protein (UniProt Q12860 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2EE2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.