3S97: PTPRZ CNTN1 complex

PTPRZ CNTN1 complex. Determined by X-ray diffraction at 2.3 Å resolution. Released 28 Sept 2011.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 4
Atoms: 7,633
Mol. weight: 108.15 kDa
Ligands: NAG
Released: 28 Sept 2011

Explore 3S97 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3S97 contains 48 α-helices and 82 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	49-51	3
α-helix	54-57	4
β-strand	65-66	2	1
α-helix	68-70	3
β-strand	72-73	2	2
α-helix	77	1
β-strand	78-83	6	2
β-strand	88	1	3
α-helix	89-90	2
β-strand	94-97	4	2
β-strand	102-115	14	2
β-strand	117-130	14	2
β-strand	143-144	2	1
β-strand	147	1	1
β-strand	151-158	8	2
α-helix	166-171	6
β-strand	176-185	10	2
α-helix	191-193	3
α-helix	194-202	9
β-strand	209-211	3	2
α-helix	212-214	3
β-strand	216	1	3
α-helix	217-220	4
β-strand	228-233	6	2
β-strand	244-249	6	2
β-strand	253-255	3	2
α-helix	257-261	5
α-helix	262-265	4
β-strand	267-272	6	4
β-strand	275-280	6	4
α-helix	286-290	5
β-strand	297-298	2	2

Chain B: 13 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	46-51	6
α-helix	54-57	4
β-strand	65-66	2	5
α-helix	68-70	3
β-strand	72-73	2	6
α-helix	77	1
β-strand	78-83	6	6
β-strand	88	1	7
α-helix	89-90	2
β-strand	94-97	4	6
β-strand	102-105	4	6
β-strand	111-115	5	6
β-strand	121-130	10	6
β-strand	143-144	2	5
β-strand	147	1	5
β-strand	151-158	8	6
α-helix	166-171	6
β-strand	176-182	7	6
β-strand	183-185	3	8
α-helix	191-193	3
α-helix	194-202	9
β-strand	209-211	3	6
α-helix	212-214	3
β-strand	216	1	7
α-helix	217-220	4
β-strand	228-233	6	6
β-strand	244-249	6	6
α-helix	252	1
β-strand	253-255	3	8
α-helix	257-263	7
β-strand	267-272	6	9
β-strand	275-280	6	9
α-helix	286-288	3
β-strand	297-298	2	6

Chain C: 13 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	134-135	2	10
α-helix	136-139	4
α-helix	142-145	4
β-strand	146-149	4	11
β-strand	154-156	3	4
α-helix	160-161	2
β-strand	163-164	2	10
β-strand	169-174	6	11
β-strand	180	1	11
α-helix	181-182	2
β-strand	187-189	3	4
α-helix	195	1
β-strand	196-198	3	4
α-helix	203-205	3
β-strand	207-215	9	11
α-helix	216-218	3
β-strand	220-223	4	11
α-helix	224-226	3
β-strand	227-232	6	11
α-helix	237-239	3
β-strand	240-247	8	12
α-helix	248-250	3
β-strand	251-254	4	13
β-strand	259-262	4	14
β-strand	263-268	6	12
α-helix	270-271	2
β-strand	272-277	6	13
β-strand	280	1	13
α-helix	281-283	3
β-strand	287-289	3	14
β-strand	294-297	4	14
α-helix	302-304	3
β-strand	306-314	9	13
β-strand	317-328	12	13

Chain D: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	134-135	2	15
α-helix	136-139	4
β-strand	146-149	4	16
β-strand	154-156	3	9
β-strand	163-164	2	15
β-strand	169-174	6	16
β-strand	176-180	5	16
α-helix	181-182	2
β-strand	187-189	3	9
β-strand	196-198	3	9
α-helix	203-205	3
β-strand	207-215	9	16
α-helix	216-218	3
β-strand	220-223	4	16
α-helix	224-226	3
β-strand	227-232	6	16
α-helix	237-239	3
β-strand	240-247	8	17
α-helix	248-250	3
β-strand	251-254	4	18
β-strand	259-262	4	19
β-strand	263-268	6	17
α-helix	270-271	2
β-strand	272-277	6	18
β-strand	280	1	18
β-strand	287-289	3	19
β-strand	294-297	4	19
α-helix	302-304	3
β-strand	306-314	9	18
β-strand	317-328	12	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Receptor-type tyrosine-protein phosphatase zeta	A, B	protein	273	Homo sapiens	P23471 (AlphaFold model)
Contactin-1	C, D	protein	201	Homo sapiens	Q12860 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3S97_1 Receptor-type tyrosine-protein phosphatase zeta (chains A, B)
GPGSEEIGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTS
LENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKF
PLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQ
AALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTM
QQSGYVMLMDYLQNNFREQQYKFSRQVFSSYTG

Sequence of entity 2 (C, D), FASTA

>3S97_2 Contactin-1 (chains C, D)
GPGSGYLDPFPPEERPEVRVKEGKGMVLLCDPPYHFPDDLSYRWLLNEFPVFITMDKRRF
VSQTNGNLYIANVEASDKGNYSCFVSSPSITKSVFSKFIPLIPIPERTTKPYPADIVVQF
KDVYALMGQNVTLECFALGNPVPDIRWRKVLEPMPSTAEISTSGAVLKIFNIQLEDEGIY
ECEAENIRGKDKHQARIYVQA

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	4

Primary citation

A complex between contactin-1 and the protein tyrosine phosphatase PTPRZ controls the development of oligodendrocyte precursor cells. Lamprianou, S., Chatzopoulou, E., Thomas, J.L. et al. Proc Natl Acad Sci U S A (2011) 108:17498-17503. DOI 10.1073/pnas.1108774108 · PubMed

Other PDB entries of the same protein (UniProt P23471 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8FN9 1.8 Å, Crystal structure of the C-terminal Fg domain of TNR with the single FN domain of PTPRZ
5AWX 1.86 Å, Crystal structure of Human PTPRZ D1 domain
8FN8 1.89 Å, Crystal structure of the C-terminal Fg domain of TNC with the single FN domain of PTPRZ
3JXF 2.0 Å, CA-like domain of human PTPRZ
5H08 2.53 Å, Human PTPRZ D1 domain complexed with NAZ2329

Browse structure collections

About this viewer

MolViewer shows 3S97 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.