2EFI: Mortality factor 4-like protein 1

Solution structure of the chromo domain of Mortality factor 4-like protein 1 from human. Determined by solution NMR. Released 28 Aug 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 810
Mol. weight: 11.52 kDa
Released: 28 Aug 2007

Explore 2EFI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2EFI contains 3 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	14-16	3
β-strand	23-27	5	1
β-strand	32-36	5	1
β-strand	37-43	7	2
β-strand	46-51	6	2
β-strand	63-64	2	2
α-helix	74-86	13
α-helix	88-92	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mortality factor 4-like protein 1	A	protein	100	Homo sapiens	Q9UBU8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2EFI_1 Mortality factor 4-like protein 1 (chains A)
GSSGSSGMAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNW
DEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAA

Primary citation

Solution structure of the chromo domain of Mortality factor 4-like protein 1 from human. Li, H., Sato, M., Tochio, N. et al. To be published.

Other PDB entries of the same protein (UniProt Q9UBU8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2F5J 2.2 Å, Crystal structure of MRG domain from human MRG15
2F5K 2.2 Å, Crystal structure of the chromo domain of human MRG15
2AQL 2.3 Å, Crystal Structure of the MRG15 MRG domain
6INE 2.6 Å, Crystal Structure of human ASH1L-MRG15 complex
7S4A 2.69 Å, MRG15 complex with PALB2 peptide
6AGO 3.1 Å, Crystal structure of MRG15-ASH1L Histone methyltransferase complex
8C60 3.4 Å, Cryo-EM structure of the human SIN3B full-length complex at 3.4 Angstrom resolution
8BPA 3.7 Å, Cryo-EM structure of the human SIN3B histone deacetylase complex at 3.7 Angstrom
2LKM Structural Basis for Molecular Interactions Involving MRG Domains: Implications in…
2N1D Solution structure of the MRG15-MRGBP complex

Browse structure collections

About this viewer

MolViewer shows 2EFI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.